Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1DAK2

Protein Details
Accession A1DAK2    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
59-91RWSIWKRDIRHQKPEKVSSRQKRTQKGEQQFAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 4.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004045  Glutathione_S-Trfase_N  
IPR036249  Thioredoxin-like_sf  
KEGG nfi:NFIA_095120  -  
Pfam View protein in Pfam  
PF13417  GST_N_3  
Amino Acid Sequences MSSPQVILYAKWYSDCSARLRLALQLKDINYVYISVDEPNAAAYKEINPSGLVPTHSPRWSIWKRDIRHQKPEKVSSRQKRTQKGEQQFAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.24
4 0.27
5 0.28
6 0.27
7 0.27
8 0.31
9 0.34
10 0.32
11 0.31
12 0.29
13 0.28
14 0.31
15 0.3
16 0.24
17 0.17
18 0.17
19 0.14
20 0.11
21 0.11
22 0.08
23 0.08
24 0.07
25 0.07
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.07
32 0.09
33 0.09
34 0.09
35 0.08
36 0.09
37 0.1
38 0.11
39 0.1
40 0.1
41 0.13
42 0.18
43 0.18
44 0.19
45 0.18
46 0.27
47 0.32
48 0.36
49 0.43
50 0.47
51 0.49
52 0.58
53 0.69
54 0.66
55 0.72
56 0.75
57 0.75
58 0.75
59 0.82
60 0.8
61 0.78
62 0.82
63 0.82
64 0.83
65 0.83
66 0.83
67 0.84
68 0.84
69 0.85
70 0.85
71 0.84