Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LE95

Protein Details
Accession A0A367LE95    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
317-336LVNPWAKMLMRRRRTTRRTRHydrophilic
NLS Segment(s)
PositionSequence
328-335RRRTTRRT
Subcellular Location(s) mito 15.5, cyto_mito 10.5, cyto 4.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001128  Cyt_P450  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF00067  p450  
CDD cd11041  CYP503A1-like  
Amino Acid Sequences MHRVLLDVISPASSRVLIGRPPCRDRRWLRLAVDFPKDVFIMASILNLLPGWSHCIVARLIPARRRILKSIRLADDTVARAGRQHAAVKEARARGEQVEEEDTLLNWMLDRRSPNECLPSAMGALQCALTLAAIHTTSMTALHLIHDLCEHPEWLPVLRDEVDSLADELGGPSEKPMATTEEWCDRLEKLDSFLVESQLRNPMTRMAKQDMRLYDGTRVRSGTVLAFAACEPDEPFDPMRSYRLRRASWPDQRDGHRAGAAHRANLTFGYGSQACPGRHFAVAEVKLVVARLLLEFDFKFLPRQSRPWTFDLNEMVLVNPWAKMLMRRRRTTRRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.15
4 0.19
5 0.27
6 0.35
7 0.42
8 0.5
9 0.57
10 0.59
11 0.66
12 0.68
13 0.71
14 0.72
15 0.72
16 0.68
17 0.69
18 0.71
19 0.68
20 0.66
21 0.57
22 0.48
23 0.42
24 0.37
25 0.29
26 0.22
27 0.15
28 0.11
29 0.1
30 0.09
31 0.08
32 0.08
33 0.08
34 0.07
35 0.07
36 0.06
37 0.06
38 0.11
39 0.11
40 0.12
41 0.12
42 0.14
43 0.15
44 0.16
45 0.21
46 0.22
47 0.27
48 0.32
49 0.38
50 0.43
51 0.5
52 0.53
53 0.55
54 0.57
55 0.6
56 0.64
57 0.66
58 0.63
59 0.58
60 0.55
61 0.49
62 0.44
63 0.37
64 0.31
65 0.23
66 0.18
67 0.17
68 0.18
69 0.19
70 0.18
71 0.21
72 0.19
73 0.24
74 0.26
75 0.28
76 0.33
77 0.32
78 0.31
79 0.28
80 0.29
81 0.25
82 0.26
83 0.23
84 0.19
85 0.19
86 0.18
87 0.17
88 0.16
89 0.14
90 0.12
91 0.11
92 0.08
93 0.06
94 0.07
95 0.07
96 0.1
97 0.12
98 0.15
99 0.19
100 0.22
101 0.25
102 0.28
103 0.28
104 0.27
105 0.26
106 0.24
107 0.2
108 0.18
109 0.16
110 0.1
111 0.1
112 0.08
113 0.07
114 0.06
115 0.05
116 0.03
117 0.03
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.05
126 0.05
127 0.04
128 0.04
129 0.05
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.08
136 0.09
137 0.08
138 0.07
139 0.09
140 0.09
141 0.1
142 0.1
143 0.09
144 0.1
145 0.1
146 0.1
147 0.09
148 0.09
149 0.08
150 0.07
151 0.08
152 0.06
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.03
159 0.03
160 0.05
161 0.05
162 0.06
163 0.07
164 0.1
165 0.11
166 0.13
167 0.15
168 0.19
169 0.2
170 0.2
171 0.2
172 0.17
173 0.18
174 0.19
175 0.16
176 0.14
177 0.14
178 0.14
179 0.15
180 0.16
181 0.16
182 0.15
183 0.15
184 0.14
185 0.18
186 0.19
187 0.17
188 0.17
189 0.21
190 0.24
191 0.27
192 0.31
193 0.3
194 0.34
195 0.36
196 0.41
197 0.36
198 0.36
199 0.34
200 0.3
201 0.32
202 0.32
203 0.32
204 0.28
205 0.27
206 0.23
207 0.22
208 0.21
209 0.15
210 0.12
211 0.1
212 0.09
213 0.09
214 0.08
215 0.09
216 0.08
217 0.08
218 0.07
219 0.08
220 0.09
221 0.11
222 0.13
223 0.14
224 0.15
225 0.16
226 0.21
227 0.25
228 0.29
229 0.35
230 0.42
231 0.42
232 0.47
233 0.55
234 0.6
235 0.64
236 0.65
237 0.63
238 0.61
239 0.64
240 0.63
241 0.57
242 0.49
243 0.41
244 0.37
245 0.32
246 0.36
247 0.32
248 0.28
249 0.27
250 0.25
251 0.23
252 0.23
253 0.22
254 0.13
255 0.11
256 0.15
257 0.13
258 0.14
259 0.17
260 0.22
261 0.21
262 0.23
263 0.27
264 0.24
265 0.25
266 0.25
267 0.24
268 0.28
269 0.28
270 0.27
271 0.24
272 0.21
273 0.2
274 0.2
275 0.17
276 0.08
277 0.07
278 0.06
279 0.08
280 0.08
281 0.11
282 0.11
283 0.13
284 0.15
285 0.15
286 0.19
287 0.21
288 0.29
289 0.31
290 0.39
291 0.46
292 0.53
293 0.58
294 0.58
295 0.62
296 0.56
297 0.57
298 0.54
299 0.47
300 0.39
301 0.34
302 0.3
303 0.23
304 0.22
305 0.17
306 0.12
307 0.1
308 0.1
309 0.11
310 0.18
311 0.28
312 0.37
313 0.46
314 0.56
315 0.66
316 0.75