Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367L932

Protein Details
Accession A0A367L932    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24NHVIEKKKRNHKVRKADADNSSKYHydrophilic
NLS Segment(s)
PositionSequence
6-14KKKRNHKVR
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences NHVIEKKKRNHKVRKADADNSSKYFSRYFKVPTCSTLTYLYKIGDLEEDLYVPYPAVSAVLRGVWVRIRPFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.87
4 0.84
5 0.8
6 0.73
7 0.65
8 0.57
9 0.47
10 0.41
11 0.36
12 0.3
13 0.25
14 0.25
15 0.27
16 0.29
17 0.34
18 0.34
19 0.33
20 0.37
21 0.35
22 0.33
23 0.32
24 0.28
25 0.24
26 0.24
27 0.21
28 0.17
29 0.15
30 0.14
31 0.1
32 0.09
33 0.09
34 0.07
35 0.07
36 0.07
37 0.08
38 0.07
39 0.07
40 0.06
41 0.05
42 0.04
43 0.05
44 0.05
45 0.06
46 0.07
47 0.07
48 0.08
49 0.08
50 0.1
51 0.13
52 0.18