Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L7J3

Protein Details
Accession A0A367L7J3   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20SRRTQKGRKKDARAHTKEHTBasic
NLS Segment(s)
PositionSequence
6-13KGRKKDAR
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 9.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences SRRTQKGRKKDARAHTKEHTQKSTHAQKERGRQTTPVGLVLSSVSLVLNLPEPFRSMSSLLLFISCPCPQSEVLFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.78
4 0.76
5 0.74
6 0.69
7 0.6
8 0.58
9 0.6
10 0.63
11 0.61
12 0.58
13 0.58
14 0.59
15 0.66
16 0.71
17 0.66
18 0.58
19 0.52
20 0.49
21 0.46
22 0.41
23 0.33
24 0.24
25 0.19
26 0.17
27 0.15
28 0.12
29 0.06
30 0.06
31 0.03
32 0.03
33 0.03
34 0.04
35 0.06
36 0.07
37 0.08
38 0.08
39 0.09
40 0.11
41 0.12
42 0.14
43 0.12
44 0.14
45 0.15
46 0.16
47 0.15
48 0.14
49 0.14
50 0.13
51 0.17
52 0.15
53 0.14
54 0.14
55 0.16
56 0.17