Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LQ08

Protein Details
Accession A0A367LQ08   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
18-67PPPPTPSSGPHPRQKKKKKKNKKQKEAEEKKKKRRRRRRVSKWSRGICDGBasic
NLS Segment(s)
PositionSequence
26-59GPHPRQKKKKKKNKKQKEAEEKKKKRRRRRRVSK
108-116KKKNQPARR
Subcellular Location(s) mito 19.5, cyto_mito 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MIGRRIGFPAPFRGRCFPPPPTPSSGPHPRQKKKKKKNKKQKEAEEKKKKRRRRRRVSKWSRGICDGGPFVRQRLFFVLCPQDLWLDVANKAKGFFLLPKPEASEHEKKKNQPARRGGRIEEAFSARVVSSSSSAGATTPRGGRFLESFYEGWKVSVPEEEEEKDDDNDAELSARMSLVGLAARHERTGAEIIGQASKQPSPTGAFHPNSLLPTYLPTYLPTYADGMRLAGADERPEKGWGGSIPDREQPAGSTDREHRPEASIACMIGPEAMVLDAAFPLIHMEFHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.62
4 0.59
5 0.59
6 0.61
7 0.61
8 0.63
9 0.62
10 0.58
11 0.6
12 0.64
13 0.61
14 0.65
15 0.7
16 0.72
17 0.79
18 0.86
19 0.88
20 0.89
21 0.93
22 0.95
23 0.96
24 0.97
25 0.97
26 0.97
27 0.97
28 0.97
29 0.97
30 0.97
31 0.97
32 0.97
33 0.96
34 0.96
35 0.95
36 0.94
37 0.94
38 0.94
39 0.94
40 0.94
41 0.95
42 0.95
43 0.97
44 0.97
45 0.97
46 0.96
47 0.93
48 0.87
49 0.79
50 0.7
51 0.59
52 0.52
53 0.44
54 0.34
55 0.3
56 0.26
57 0.24
58 0.25
59 0.24
60 0.22
61 0.24
62 0.26
63 0.23
64 0.28
65 0.31
66 0.27
67 0.27
68 0.26
69 0.21
70 0.18
71 0.19
72 0.15
73 0.12
74 0.13
75 0.17
76 0.17
77 0.17
78 0.17
79 0.16
80 0.14
81 0.14
82 0.17
83 0.18
84 0.25
85 0.25
86 0.26
87 0.28
88 0.28
89 0.31
90 0.33
91 0.37
92 0.37
93 0.46
94 0.5
95 0.52
96 0.61
97 0.66
98 0.66
99 0.66
100 0.69
101 0.68
102 0.72
103 0.72
104 0.63
105 0.63
106 0.57
107 0.49
108 0.41
109 0.34
110 0.25
111 0.22
112 0.21
113 0.12
114 0.11
115 0.09
116 0.07
117 0.07
118 0.07
119 0.07
120 0.06
121 0.07
122 0.07
123 0.07
124 0.07
125 0.08
126 0.11
127 0.1
128 0.12
129 0.12
130 0.13
131 0.13
132 0.14
133 0.13
134 0.13
135 0.12
136 0.12
137 0.15
138 0.13
139 0.13
140 0.12
141 0.11
142 0.09
143 0.11
144 0.11
145 0.1
146 0.12
147 0.13
148 0.13
149 0.14
150 0.15
151 0.13
152 0.12
153 0.11
154 0.09
155 0.09
156 0.07
157 0.07
158 0.05
159 0.06
160 0.05
161 0.05
162 0.04
163 0.04
164 0.04
165 0.04
166 0.05
167 0.05
168 0.07
169 0.09
170 0.1
171 0.1
172 0.1
173 0.1
174 0.11
175 0.13
176 0.11
177 0.09
178 0.11
179 0.11
180 0.13
181 0.13
182 0.11
183 0.11
184 0.12
185 0.12
186 0.1
187 0.11
188 0.13
189 0.16
190 0.21
191 0.28
192 0.28
193 0.28
194 0.3
195 0.3
196 0.27
197 0.26
198 0.21
199 0.13
200 0.14
201 0.16
202 0.15
203 0.14
204 0.14
205 0.17
206 0.17
207 0.18
208 0.16
209 0.17
210 0.16
211 0.17
212 0.16
213 0.13
214 0.12
215 0.11
216 0.11
217 0.1
218 0.1
219 0.13
220 0.14
221 0.16
222 0.17
223 0.18
224 0.18
225 0.16
226 0.19
227 0.16
228 0.22
229 0.25
230 0.28
231 0.3
232 0.33
233 0.35
234 0.33
235 0.32
236 0.25
237 0.25
238 0.24
239 0.22
240 0.23
241 0.28
242 0.36
243 0.4
244 0.41
245 0.38
246 0.38
247 0.42
248 0.38
249 0.36
250 0.28
251 0.24
252 0.22
253 0.21
254 0.17
255 0.13
256 0.11
257 0.06
258 0.05
259 0.05
260 0.05
261 0.05
262 0.05
263 0.05
264 0.05
265 0.05
266 0.04
267 0.06
268 0.06