Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L8M2

Protein Details
Accession A0A367L8M2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-111QLSKGGRRRTKVKFMRRDEEVBasic
NLS Segment(s)
PositionSequence
94-103KGGRRRTKVK
Subcellular Location(s) mito 14, cyto 8.5, cyto_nucl 5.5, plas 2
Family & Domain DBs
Amino Acid Sequences MTVFAGFVGPVVIMGSWPEGAASRFPSFLSLAVDAIEFLQSNASLPAAYRLGFNRRQIRLVPSPWFPSVEKNKASHGVVRKKSYADSDREQLSKGGRRRTKVKFMRRDEEVEKASRLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.06
5 0.06
6 0.07
7 0.08
8 0.1
9 0.14
10 0.14
11 0.14
12 0.14
13 0.16
14 0.16
15 0.16
16 0.16
17 0.13
18 0.12
19 0.11
20 0.11
21 0.09
22 0.09
23 0.08
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.07
34 0.07
35 0.07
36 0.08
37 0.1
38 0.15
39 0.2
40 0.26
41 0.32
42 0.32
43 0.34
44 0.34
45 0.39
46 0.38
47 0.37
48 0.34
49 0.29
50 0.31
51 0.3
52 0.3
53 0.25
54 0.28
55 0.32
56 0.35
57 0.36
58 0.34
59 0.35
60 0.37
61 0.37
62 0.35
63 0.36
64 0.4
65 0.43
66 0.46
67 0.46
68 0.43
69 0.44
70 0.46
71 0.43
72 0.4
73 0.38
74 0.39
75 0.41
76 0.4
77 0.39
78 0.34
79 0.34
80 0.36
81 0.38
82 0.43
83 0.45
84 0.5
85 0.58
86 0.65
87 0.7
88 0.72
89 0.77
90 0.77
91 0.8
92 0.82
93 0.78
94 0.77
95 0.7
96 0.68
97 0.61
98 0.55