Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L809

Protein Details
Accession A0A367L809    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-98VSTTPRPPSRRDSQRRRDALLKHydrophilic
NLS Segment(s)
PositionSequence
92-92R
Subcellular Location(s) nucl 12, mito_nucl 10.166, cyto_nucl 9.666, cyto_mito 7.166, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR025952  R3H-assoc_dom  
Pfam View protein in Pfam  
PF13902  R3H-assoc  
Amino Acid Sequences MAIYSAVPPPAEFTTGQQQQQQQQQQANNDVDAWTVSALQSLTVSPVARGTGATALAIPIDGQDRSAQTVVGPKATVSTTPRPPSRRDSQRRRDALLKGHEGSRQRRRWDNDRLVGVPNVQPPLPCDWQVRPTHPVHHIPYQLAHFWDCGMRQRAQDKAATLAAARKKQQRTTGSATGLGVGEVPRDLRESAKRSPNVRFWVRALEEPVRSYLTGDGVKDEEEKEEEEEEEEEEADDSAAERMDSDDEEIVFVGRSGAMRELREKRESRCKMARREVDHRTVDSGVVFDSFGDGDAAAFKRWLAHSISDYYGLSSRSVTLADSSCRVVYVGLKQEERRRGELPRPLWEVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.37
4 0.38
5 0.43
6 0.47
7 0.56
8 0.59
9 0.55
10 0.56
11 0.59
12 0.59
13 0.61
14 0.56
15 0.47
16 0.4
17 0.33
18 0.27
19 0.22
20 0.17
21 0.1
22 0.08
23 0.07
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.11
31 0.12
32 0.1
33 0.11
34 0.12
35 0.11
36 0.11
37 0.11
38 0.1
39 0.1
40 0.1
41 0.09
42 0.09
43 0.08
44 0.08
45 0.06
46 0.05
47 0.07
48 0.07
49 0.08
50 0.1
51 0.11
52 0.14
53 0.14
54 0.13
55 0.12
56 0.2
57 0.2
58 0.19
59 0.18
60 0.15
61 0.17
62 0.18
63 0.2
64 0.19
65 0.25
66 0.31
67 0.39
68 0.46
69 0.47
70 0.52
71 0.56
72 0.61
73 0.65
74 0.68
75 0.72
76 0.76
77 0.83
78 0.83
79 0.8
80 0.77
81 0.7
82 0.68
83 0.64
84 0.59
85 0.5
86 0.48
87 0.47
88 0.46
89 0.5
90 0.52
91 0.51
92 0.51
93 0.58
94 0.62
95 0.67
96 0.71
97 0.72
98 0.68
99 0.65
100 0.61
101 0.55
102 0.49
103 0.42
104 0.34
105 0.27
106 0.22
107 0.18
108 0.17
109 0.16
110 0.22
111 0.22
112 0.21
113 0.22
114 0.24
115 0.31
116 0.34
117 0.36
118 0.35
119 0.35
120 0.38
121 0.39
122 0.43
123 0.39
124 0.41
125 0.39
126 0.34
127 0.35
128 0.31
129 0.28
130 0.23
131 0.19
132 0.13
133 0.12
134 0.13
135 0.11
136 0.15
137 0.17
138 0.19
139 0.21
140 0.24
141 0.26
142 0.27
143 0.28
144 0.22
145 0.21
146 0.2
147 0.17
148 0.14
149 0.16
150 0.19
151 0.2
152 0.24
153 0.29
154 0.32
155 0.36
156 0.44
157 0.43
158 0.45
159 0.49
160 0.5
161 0.43
162 0.4
163 0.36
164 0.29
165 0.25
166 0.18
167 0.11
168 0.06
169 0.05
170 0.04
171 0.05
172 0.04
173 0.06
174 0.06
175 0.09
176 0.14
177 0.19
178 0.25
179 0.33
180 0.37
181 0.39
182 0.44
183 0.47
184 0.49
185 0.47
186 0.44
187 0.37
188 0.4
189 0.38
190 0.35
191 0.32
192 0.29
193 0.27
194 0.26
195 0.26
196 0.2
197 0.18
198 0.17
199 0.14
200 0.13
201 0.13
202 0.12
203 0.12
204 0.11
205 0.12
206 0.12
207 0.12
208 0.1
209 0.1
210 0.11
211 0.11
212 0.11
213 0.11
214 0.11
215 0.11
216 0.1
217 0.09
218 0.08
219 0.07
220 0.07
221 0.06
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.04
228 0.04
229 0.05
230 0.06
231 0.06
232 0.07
233 0.08
234 0.08
235 0.08
236 0.08
237 0.07
238 0.07
239 0.06
240 0.05
241 0.05
242 0.05
243 0.06
244 0.1
245 0.12
246 0.14
247 0.22
248 0.29
249 0.34
250 0.42
251 0.44
252 0.47
253 0.56
254 0.6
255 0.61
256 0.64
257 0.67
258 0.69
259 0.76
260 0.77
261 0.74
262 0.77
263 0.76
264 0.75
265 0.7
266 0.61
267 0.54
268 0.47
269 0.39
270 0.31
271 0.24
272 0.15
273 0.12
274 0.1
275 0.07
276 0.07
277 0.06
278 0.06
279 0.06
280 0.06
281 0.05
282 0.09
283 0.1
284 0.1
285 0.1
286 0.1
287 0.13
288 0.14
289 0.17
290 0.17
291 0.19
292 0.22
293 0.26
294 0.28
295 0.26
296 0.26
297 0.24
298 0.24
299 0.21
300 0.18
301 0.15
302 0.15
303 0.13
304 0.14
305 0.12
306 0.13
307 0.15
308 0.17
309 0.19
310 0.2
311 0.19
312 0.19
313 0.19
314 0.16
315 0.17
316 0.22
317 0.29
318 0.33
319 0.37
320 0.43
321 0.52
322 0.59
323 0.61
324 0.58
325 0.53
326 0.55
327 0.59
328 0.63
329 0.6
330 0.6