Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LN99

Protein Details
Accession A0A367LN99    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-32APEGKPQPGPPRRRDQNQKNLPCRFCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MFPNHHAPEGKPQPGPPRRRDQNQKNLPCRFCPRRFRRVEHVQRHERTHTKEKPFPCNWCGCGKRFARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.59
4 0.62
5 0.66
6 0.74
7 0.81
8 0.8
9 0.83
10 0.85
11 0.87
12 0.85
13 0.85
14 0.77
15 0.72
16 0.7
17 0.68
18 0.66
19 0.67
20 0.66
21 0.68
22 0.72
23 0.72
24 0.72
25 0.75
26 0.76
27 0.76
28 0.78
29 0.77
30 0.76
31 0.74
32 0.72
33 0.67
34 0.64
35 0.64
36 0.63
37 0.62
38 0.65
39 0.66
40 0.69
41 0.69
42 0.68
43 0.64
44 0.62
45 0.56
46 0.6
47 0.58
48 0.52
49 0.55