Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LEC5

Protein Details
Accession A0A367LEC5    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-88TPALHRPPRNRNSRMKCHVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 11, cyto 2, nucl 1, plas 1, E.R. 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MNATRLIPGDGLGFQMVNATRGCLSALLRGLVSRRQPYSASLDLVRLVPSPRLSSSLVLQTIAVPVLLTPALHRPPRNRNSRMKCHVCGISETPEWRCGPDGIGTLCNVCGLIFAKQQRKQSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.12
3 0.11
4 0.11
5 0.11
6 0.11
7 0.11
8 0.12
9 0.12
10 0.1
11 0.11
12 0.13
13 0.14
14 0.14
15 0.13
16 0.14
17 0.15
18 0.19
19 0.23
20 0.24
21 0.24
22 0.25
23 0.26
24 0.28
25 0.33
26 0.3
27 0.27
28 0.23
29 0.22
30 0.21
31 0.21
32 0.18
33 0.13
34 0.11
35 0.11
36 0.12
37 0.13
38 0.12
39 0.15
40 0.15
41 0.15
42 0.16
43 0.17
44 0.16
45 0.15
46 0.14
47 0.11
48 0.1
49 0.09
50 0.07
51 0.04
52 0.03
53 0.04
54 0.04
55 0.03
56 0.04
57 0.08
58 0.13
59 0.16
60 0.19
61 0.25
62 0.36
63 0.45
64 0.54
65 0.57
66 0.63
67 0.7
68 0.77
69 0.8
70 0.77
71 0.71
72 0.66
73 0.63
74 0.53
75 0.48
76 0.41
77 0.37
78 0.32
79 0.32
80 0.29
81 0.3
82 0.29
83 0.26
84 0.25
85 0.2
86 0.19
87 0.19
88 0.21
89 0.19
90 0.2
91 0.19
92 0.18
93 0.17
94 0.16
95 0.13
96 0.09
97 0.09
98 0.09
99 0.12
100 0.18
101 0.26
102 0.35
103 0.41