Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LM67

Protein Details
Accession A0A367LM67    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
103-130RILPRPKRSARSRNTQKQKRPRSRTLTAHydrophilic
NLS Segment(s)
PositionSequence
102-125RRILPRPKRSARSRNTQKQKRPRS
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
PROSITE View protein in PROSITE  
PS00948  RIBOSOMAL_S7E  
Amino Acid Sequences MSAQALNKIAPNSPSRQNPSELEQNIAQALYDLETNTTDLKVALRPLQIVSAREIEVGHGKKAIVIFVPVPSLAGFHKVQQRLTRELEKKFSDRHVLILASRRILPRPKRSARSRNTQKQKRPRSRTLTAVHDAILGDLCYPVEIVGKRIRTKEDGSKLLKVILDEKERGGVDYRLDTYSEVYRRLTGRNVNFEFPQSGAAEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.49
4 0.51
5 0.5
6 0.51
7 0.55
8 0.49
9 0.44
10 0.37
11 0.35
12 0.31
13 0.28
14 0.21
15 0.12
16 0.11
17 0.08
18 0.08
19 0.07
20 0.07
21 0.08
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.1
28 0.11
29 0.13
30 0.16
31 0.16
32 0.17
33 0.17
34 0.22
35 0.23
36 0.22
37 0.22
38 0.21
39 0.2
40 0.19
41 0.19
42 0.15
43 0.2
44 0.2
45 0.18
46 0.17
47 0.16
48 0.17
49 0.18
50 0.17
51 0.1
52 0.1
53 0.1
54 0.09
55 0.1
56 0.08
57 0.08
58 0.07
59 0.08
60 0.07
61 0.1
62 0.1
63 0.13
64 0.2
65 0.21
66 0.24
67 0.29
68 0.33
69 0.34
70 0.38
71 0.43
72 0.42
73 0.43
74 0.46
75 0.43
76 0.42
77 0.4
78 0.38
79 0.35
80 0.3
81 0.29
82 0.25
83 0.22
84 0.21
85 0.25
86 0.23
87 0.18
88 0.19
89 0.18
90 0.19
91 0.26
92 0.32
93 0.36
94 0.45
95 0.51
96 0.58
97 0.67
98 0.74
99 0.73
100 0.77
101 0.78
102 0.78
103 0.82
104 0.83
105 0.84
106 0.84
107 0.9
108 0.89
109 0.88
110 0.87
111 0.84
112 0.8
113 0.78
114 0.72
115 0.68
116 0.6
117 0.51
118 0.42
119 0.34
120 0.29
121 0.21
122 0.16
123 0.09
124 0.06
125 0.05
126 0.05
127 0.04
128 0.04
129 0.04
130 0.08
131 0.08
132 0.11
133 0.16
134 0.22
135 0.25
136 0.27
137 0.31
138 0.31
139 0.36
140 0.43
141 0.45
142 0.48
143 0.49
144 0.51
145 0.48
146 0.46
147 0.42
148 0.33
149 0.3
150 0.28
151 0.29
152 0.26
153 0.26
154 0.28
155 0.27
156 0.27
157 0.26
158 0.21
159 0.19
160 0.21
161 0.23
162 0.2
163 0.2
164 0.2
165 0.19
166 0.25
167 0.25
168 0.24
169 0.23
170 0.27
171 0.28
172 0.31
173 0.35
174 0.37
175 0.41
176 0.49
177 0.52
178 0.51
179 0.51
180 0.5
181 0.45
182 0.37
183 0.32