Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LBK3

Protein Details
Accession A0A367LBK3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-71TAVRAVRAVRRKERRPRYGYLRLRLLHydrophilic
NLS Segment(s)
PositionSequence
38-62RRLRRIAATAVRAVRAVRRKERRPR
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences ALDTLTHTQGTRPEGLGGSRDARPAVAGPRPPYVIEARRLRRIAATAVRAVRAVRRKERRPRYGYLRLRLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.19
5 0.19
6 0.18
7 0.18
8 0.16
9 0.15
10 0.15
11 0.14
12 0.15
13 0.17
14 0.19
15 0.2
16 0.22
17 0.23
18 0.23
19 0.23
20 0.24
21 0.23
22 0.27
23 0.33
24 0.34
25 0.4
26 0.4
27 0.39
28 0.35
29 0.34
30 0.32
31 0.29
32 0.28
33 0.26
34 0.26
35 0.26
36 0.26
37 0.25
38 0.26
39 0.29
40 0.34
41 0.4
42 0.49
43 0.59
44 0.69
45 0.8
46 0.84
47 0.82
48 0.84
49 0.83
50 0.84
51 0.83