Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LB70

Protein Details
Accession A0A367LB70    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
37-59ALSPTNHRRPRPKPSTNFKACCGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022617  Rad60/SUMO-like_dom  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Pfam View protein in Pfam  
PF11976  Rad60-SLD  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd16116  Ubl_Smt3_like  
Amino Acid Sequences LLFNTSHSQVSEQKPPEILGRLLSITQRPRQTDLGPALSPTNHRRPRPKPSTNFKACCGRSSPCPPTFPCQRTSVSLLTTRGQFAMSAEREASPDHQQEPPANSEHLNIKVTDNNNEVFFKIKRSTKLEKLMNAFCERQGKNITSVRFLFDGTRVQPTDTPDSLEMADGDTLEVHQEQVGGWRYTTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.4
4 0.37
5 0.32
6 0.25
7 0.24
8 0.22
9 0.22
10 0.23
11 0.25
12 0.27
13 0.33
14 0.37
15 0.38
16 0.41
17 0.44
18 0.42
19 0.44
20 0.43
21 0.41
22 0.36
23 0.34
24 0.31
25 0.28
26 0.31
27 0.31
28 0.36
29 0.39
30 0.44
31 0.53
32 0.6
33 0.7
34 0.75
35 0.79
36 0.78
37 0.81
38 0.85
39 0.86
40 0.81
41 0.75
42 0.74
43 0.64
44 0.58
45 0.51
46 0.43
47 0.4
48 0.46
49 0.49
50 0.43
51 0.46
52 0.45
53 0.47
54 0.54
55 0.49
56 0.43
57 0.39
58 0.37
59 0.37
60 0.39
61 0.34
62 0.27
63 0.27
64 0.26
65 0.24
66 0.23
67 0.2
68 0.16
69 0.14
70 0.12
71 0.1
72 0.14
73 0.13
74 0.12
75 0.13
76 0.13
77 0.13
78 0.13
79 0.15
80 0.13
81 0.14
82 0.15
83 0.16
84 0.17
85 0.18
86 0.2
87 0.2
88 0.18
89 0.17
90 0.15
91 0.16
92 0.18
93 0.18
94 0.17
95 0.15
96 0.15
97 0.18
98 0.19
99 0.21
100 0.2
101 0.18
102 0.19
103 0.19
104 0.18
105 0.17
106 0.16
107 0.17
108 0.21
109 0.25
110 0.28
111 0.35
112 0.42
113 0.46
114 0.55
115 0.56
116 0.55
117 0.57
118 0.55
119 0.52
120 0.49
121 0.42
122 0.36
123 0.4
124 0.34
125 0.33
126 0.34
127 0.31
128 0.34
129 0.39
130 0.37
131 0.33
132 0.34
133 0.32
134 0.28
135 0.27
136 0.22
137 0.19
138 0.23
139 0.2
140 0.25
141 0.23
142 0.24
143 0.26
144 0.3
145 0.34
146 0.3
147 0.32
148 0.26
149 0.27
150 0.26
151 0.24
152 0.19
153 0.13
154 0.13
155 0.09
156 0.09
157 0.07
158 0.07
159 0.08
160 0.08
161 0.07
162 0.07
163 0.07
164 0.07
165 0.14
166 0.2
167 0.19