Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LGX4

Protein Details
Accession A0A367LGX4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-86VAIFRKKSKRKLGAGRGRRGGBasic
NLS Segment(s)
PositionSequence
70-89RKKSKRKLGAGRGRRGGGTA
Subcellular Location(s) cyto 19.5, cyto_nucl 10.5, extr 5
Family & Domain DBs
Amino Acid Sequences DSGAISEGGSCDVLAENRCLGMQIVALIYIEEGLALALNETVGGEARDWRLAVSIKLSLLDSHYVVAIFRKKSKRKLGAGRGRRGGGTAPRAAPSSYFLEATGSRGVCGSGPVLVLAGHFAIPGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.12
5 0.12
6 0.12
7 0.12
8 0.1
9 0.08
10 0.07
11 0.07
12 0.07
13 0.07
14 0.06
15 0.05
16 0.05
17 0.04
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.04
32 0.06
33 0.07
34 0.08
35 0.08
36 0.08
37 0.1
38 0.1
39 0.1
40 0.1
41 0.1
42 0.09
43 0.1
44 0.1
45 0.08
46 0.08
47 0.09
48 0.08
49 0.07
50 0.07
51 0.06
52 0.06
53 0.09
54 0.12
55 0.12
56 0.19
57 0.28
58 0.34
59 0.43
60 0.53
61 0.59
62 0.64
63 0.72
64 0.77
65 0.78
66 0.82
67 0.8
68 0.74
69 0.67
70 0.58
71 0.48
72 0.41
73 0.36
74 0.32
75 0.28
76 0.25
77 0.25
78 0.27
79 0.26
80 0.23
81 0.21
82 0.2
83 0.18
84 0.17
85 0.16
86 0.17
87 0.17
88 0.19
89 0.2
90 0.16
91 0.15
92 0.15
93 0.15
94 0.12
95 0.13
96 0.11
97 0.08
98 0.08
99 0.08
100 0.08
101 0.07
102 0.07
103 0.07
104 0.07
105 0.06