Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LPT7

Protein Details
Accession A0A367LPT7    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-25LADYRRPQGRRRPASRIRPRNGSCHydrophilic
NLS Segment(s)
PositionSequence
7-21RPQGRRRPASRIRPR
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
Amino Acid Sequences PLADYRRPQGRRRPASRIRPRNGSCIPRISVASARSTIRSKPARSRLRLIRAPITTAQNCGRCPRYPLQDEHWDKHLRLGYKAKQARFKYIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.89
4 0.89
5 0.84
6 0.84
7 0.79
8 0.78
9 0.75
10 0.7
11 0.63
12 0.58
13 0.52
14 0.44
15 0.42
16 0.35
17 0.32
18 0.27
19 0.25
20 0.22
21 0.21
22 0.22
23 0.23
24 0.21
25 0.25
26 0.3
27 0.31
28 0.38
29 0.47
30 0.53
31 0.55
32 0.61
33 0.6
34 0.63
35 0.62
36 0.57
37 0.53
38 0.45
39 0.44
40 0.39
41 0.38
42 0.3
43 0.3
44 0.31
45 0.28
46 0.29
47 0.31
48 0.31
49 0.27
50 0.32
51 0.35
52 0.39
53 0.4
54 0.44
55 0.46
56 0.53
57 0.57
58 0.55
59 0.56
60 0.51
61 0.46
62 0.48
63 0.46
64 0.38
65 0.38
66 0.44
67 0.45
68 0.52
69 0.58
70 0.58
71 0.63
72 0.64
73 0.69