Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LFV5

Protein Details
Accession A0A367LFV5   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-52QSIPTAFFKPCRRKYRRRLRLRLRLRLYGHydrophilic
NLS Segment(s)
PositionSequence
36-45RKYRRRLRLR
Subcellular Location(s) mito 14, nucl 4.5, extr 4, cyto_nucl 4, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPSSVEKSALATAPAPAPALTNRQSIPTAFFKPCRRKYRRRLRLRLRLRLYGPYGPYEGRNVGLGDLLRPVYNGFRLYRLSYLQPSHDDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.11
4 0.12
5 0.12
6 0.17
7 0.18
8 0.2
9 0.2
10 0.22
11 0.23
12 0.22
13 0.25
14 0.24
15 0.27
16 0.26
17 0.33
18 0.39
19 0.49
20 0.58
21 0.64
22 0.68
23 0.73
24 0.81
25 0.87
26 0.88
27 0.89
28 0.9
29 0.9
30 0.92
31 0.91
32 0.9
33 0.83
34 0.77
35 0.68
36 0.62
37 0.54
38 0.47
39 0.39
40 0.31
41 0.28
42 0.23
43 0.22
44 0.2
45 0.17
46 0.14
47 0.14
48 0.12
49 0.11
50 0.12
51 0.11
52 0.09
53 0.1
54 0.1
55 0.09
56 0.09
57 0.09
58 0.1
59 0.13
60 0.15
61 0.15
62 0.18
63 0.21
64 0.23
65 0.25
66 0.26
67 0.28
68 0.31
69 0.33
70 0.34
71 0.35