Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LN24

Protein Details
Accession A0A367LN24   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-44RPIEYKDKENNNNNTKNKKSKKLWPPRRDRQREREPPRTAFHydrophilic
NLS Segment(s)
PositionSequence
19-38KNKKSKKLWPPRRDRQRERE
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Amino Acid Sequences MVDRPIEYKDKENNNNNTKNKKSKKLWPPRRDRQREREPPRTAFQVTDGYLDLALLVCTVTETEVLGPQQLGEGEASLVVSEGEAANASSLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.8
4 0.8
5 0.78
6 0.8
7 0.79
8 0.79
9 0.77
10 0.78
11 0.81
12 0.83
13 0.86
14 0.86
15 0.88
16 0.89
17 0.93
18 0.93
19 0.91
20 0.9
21 0.9
22 0.91
23 0.89
24 0.88
25 0.82
26 0.75
27 0.69
28 0.63
29 0.52
30 0.42
31 0.35
32 0.28
33 0.23
34 0.2
35 0.17
36 0.13
37 0.12
38 0.11
39 0.08
40 0.05
41 0.04
42 0.03
43 0.03
44 0.02
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.06
52 0.07
53 0.07
54 0.07
55 0.06
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.05
62 0.06
63 0.06
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05