Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367KZ53

Protein Details
Accession A0A367KZ53    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-72RACSRWCRRRGVSHQRRGGCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 3, plas 2
Family & Domain DBs
Amino Acid Sequences MKLVLPIFALVGTVLCTARYYKGQPTWSGRLFASVPQRGGTCWHPSGCVTSARACSRWCRRRGVSHQRRGGCEDGRVVCCCKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.12
6 0.15
7 0.17
8 0.22
9 0.29
10 0.32
11 0.37
12 0.42
13 0.47
14 0.45
15 0.44
16 0.37
17 0.34
18 0.31
19 0.3
20 0.3
21 0.26
22 0.24
23 0.23
24 0.23
25 0.21
26 0.23
27 0.22
28 0.18
29 0.18
30 0.17
31 0.17
32 0.17
33 0.2
34 0.19
35 0.18
36 0.15
37 0.16
38 0.21
39 0.23
40 0.24
41 0.23
42 0.3
43 0.39
44 0.46
45 0.48
46 0.51
47 0.55
48 0.63
49 0.73
50 0.76
51 0.76
52 0.77
53 0.82
54 0.78
55 0.76
56 0.71
57 0.66
58 0.57
59 0.49
60 0.45
61 0.42
62 0.41
63 0.4
64 0.38