Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L5K1

Protein Details
Accession A0A367L5K1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-63PLLFRSSSQRSRRSRSRERPMSKQTAKSTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 7, extr 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR041622  SLATT_fungi  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF18142  SLATT_fungal  
Amino Acid Sequences MASNPRSSPQTEHPFIYRHCPIIFSLLNWLLPRLPLLFRSSSQRSRRSRSRERPMSKQTAKSTELPVLPPVPDTSRDEPVKQGGTQPAGAAPDPGSQWHAHGFPAVSRHRFLTSAEWTTIATGIGGVGDLEGHKPVHPTSWWWPPRGLPRGLYRDIVTRRTNIVRWALMVGQLLIGAAITSLGSMSMSSGMPITVLGAMNTIIAGMLALLHNSGLPDRYRYDMAQFEELEDRVKEILDSGIAPIDMTTDQVLAECFDLFRMAKATVTANMPVNYNSRQALQSGTGSAEPRPDPTATRPSMATASADSPVVGGGDKKKDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.52
4 0.46
5 0.41
6 0.37
7 0.36
8 0.33
9 0.35
10 0.34
11 0.26
12 0.29
13 0.27
14 0.29
15 0.28
16 0.28
17 0.21
18 0.2
19 0.21
20 0.16
21 0.16
22 0.16
23 0.2
24 0.22
25 0.23
26 0.31
27 0.38
28 0.44
29 0.51
30 0.58
31 0.62
32 0.68
33 0.76
34 0.78
35 0.82
36 0.83
37 0.86
38 0.87
39 0.86
40 0.87
41 0.87
42 0.88
43 0.84
44 0.81
45 0.77
46 0.72
47 0.69
48 0.63
49 0.56
50 0.51
51 0.46
52 0.39
53 0.35
54 0.3
55 0.26
56 0.23
57 0.22
58 0.18
59 0.19
60 0.24
61 0.26
62 0.32
63 0.34
64 0.34
65 0.34
66 0.37
67 0.36
68 0.3
69 0.3
70 0.27
71 0.27
72 0.26
73 0.24
74 0.2
75 0.19
76 0.19
77 0.15
78 0.12
79 0.12
80 0.12
81 0.12
82 0.13
83 0.12
84 0.13
85 0.14
86 0.14
87 0.12
88 0.13
89 0.13
90 0.12
91 0.19
92 0.22
93 0.22
94 0.22
95 0.24
96 0.24
97 0.24
98 0.24
99 0.23
100 0.24
101 0.24
102 0.24
103 0.23
104 0.21
105 0.21
106 0.19
107 0.13
108 0.08
109 0.05
110 0.04
111 0.03
112 0.03
113 0.03
114 0.02
115 0.02
116 0.03
117 0.03
118 0.04
119 0.05
120 0.05
121 0.07
122 0.07
123 0.09
124 0.09
125 0.13
126 0.17
127 0.27
128 0.29
129 0.3
130 0.31
131 0.33
132 0.41
133 0.42
134 0.39
135 0.32
136 0.37
137 0.41
138 0.42
139 0.39
140 0.31
141 0.33
142 0.34
143 0.36
144 0.3
145 0.25
146 0.27
147 0.28
148 0.28
149 0.24
150 0.24
151 0.19
152 0.18
153 0.18
154 0.15
155 0.14
156 0.13
157 0.09
158 0.06
159 0.06
160 0.05
161 0.04
162 0.04
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.03
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.04
182 0.05
183 0.04
184 0.05
185 0.05
186 0.05
187 0.05
188 0.04
189 0.03
190 0.03
191 0.02
192 0.02
193 0.02
194 0.02
195 0.03
196 0.03
197 0.03
198 0.03
199 0.04
200 0.04
201 0.06
202 0.07
203 0.09
204 0.11
205 0.14
206 0.16
207 0.16
208 0.2
209 0.22
210 0.24
211 0.26
212 0.24
213 0.23
214 0.23
215 0.23
216 0.21
217 0.17
218 0.15
219 0.11
220 0.11
221 0.09
222 0.08
223 0.08
224 0.07
225 0.07
226 0.07
227 0.07
228 0.07
229 0.07
230 0.06
231 0.07
232 0.06
233 0.07
234 0.07
235 0.06
236 0.06
237 0.07
238 0.07
239 0.06
240 0.07
241 0.06
242 0.06
243 0.06
244 0.08
245 0.08
246 0.09
247 0.11
248 0.1
249 0.11
250 0.12
251 0.14
252 0.15
253 0.17
254 0.19
255 0.2
256 0.21
257 0.22
258 0.22
259 0.24
260 0.24
261 0.24
262 0.23
263 0.21
264 0.21
265 0.21
266 0.22
267 0.2
268 0.2
269 0.18
270 0.19
271 0.18
272 0.19
273 0.19
274 0.21
275 0.19
276 0.21
277 0.23
278 0.22
279 0.24
280 0.29
281 0.38
282 0.35
283 0.37
284 0.35
285 0.35
286 0.35
287 0.33
288 0.28
289 0.2
290 0.2
291 0.19
292 0.18
293 0.15
294 0.13
295 0.12
296 0.11
297 0.09
298 0.11
299 0.16