Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LAC0

Protein Details
Accession A0A367LAC0   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-99FNPDLHKTPNPRKLRRKPKPVAFISAFHydrophilic
NLS Segment(s)
PositionSequence
83-91PRKLRRKPK
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, mito 3
Family & Domain DBs
Amino Acid Sequences MDACAPAPPPTHSNKDGYGKMPLSKLQSICHCRLFFFTLSGVMEDKGAELQVVKQATHLFTLLPPLFHQLLIFNPDLHKTPNPRKLRRKPKPVAFISAFSKQTPIHLSSFQISNSQGPRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.46
4 0.44
5 0.45
6 0.4
7 0.4
8 0.39
9 0.36
10 0.34
11 0.36
12 0.35
13 0.32
14 0.39
15 0.43
16 0.44
17 0.48
18 0.43
19 0.38
20 0.4
21 0.39
22 0.3
23 0.25
24 0.22
25 0.16
26 0.16
27 0.17
28 0.14
29 0.1
30 0.1
31 0.08
32 0.08
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.08
39 0.09
40 0.08
41 0.09
42 0.1
43 0.11
44 0.11
45 0.11
46 0.08
47 0.07
48 0.12
49 0.11
50 0.11
51 0.1
52 0.13
53 0.13
54 0.13
55 0.13
56 0.09
57 0.1
58 0.13
59 0.13
60 0.11
61 0.11
62 0.12
63 0.13
64 0.15
65 0.18
66 0.23
67 0.32
68 0.41
69 0.5
70 0.59
71 0.69
72 0.77
73 0.85
74 0.88
75 0.89
76 0.9
77 0.9
78 0.9
79 0.83
80 0.81
81 0.72
82 0.66
83 0.6
84 0.57
85 0.48
86 0.38
87 0.37
88 0.29
89 0.29
90 0.29
91 0.28
92 0.24
93 0.25
94 0.27
95 0.27
96 0.29
97 0.26
98 0.25
99 0.24
100 0.26