Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LNP7

Protein Details
Accession A0A367LNP7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
99-133KAEMTRGGRKKERREKKKQKKKKKRKKKKKTPGQIBasic
NLS Segment(s)
PositionSequence
96-130RKAKAEMTRGGRKKERREKKKQKKKKKRKKKKKTP
Subcellular Location(s) mito 11, nucl 9, cyto 6
Family & Domain DBs
Amino Acid Sequences MMEWRWDGVQRGDRLASWHRIHAYYIRFFSNLTTDTGEGKARGRGKQSYHTTDYGVLVYPRTFSHMGRKGTANQRRRPLWQFVVLPPPLVCFVSGRKAKAEMTRGGRKKERREKKKQKKKKKRKKKKKTPGQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.39
4 0.33
5 0.36
6 0.36
7 0.36
8 0.37
9 0.38
10 0.38
11 0.35
12 0.35
13 0.32
14 0.29
15 0.28
16 0.27
17 0.25
18 0.21
19 0.17
20 0.17
21 0.16
22 0.17
23 0.19
24 0.18
25 0.15
26 0.15
27 0.19
28 0.21
29 0.23
30 0.26
31 0.3
32 0.32
33 0.41
34 0.46
35 0.47
36 0.47
37 0.45
38 0.42
39 0.38
40 0.35
41 0.26
42 0.2
43 0.13
44 0.1
45 0.09
46 0.09
47 0.08
48 0.11
49 0.11
50 0.11
51 0.21
52 0.27
53 0.29
54 0.29
55 0.31
56 0.34
57 0.42
58 0.5
59 0.49
60 0.48
61 0.54
62 0.55
63 0.59
64 0.58
65 0.55
66 0.5
67 0.47
68 0.44
69 0.39
70 0.43
71 0.37
72 0.33
73 0.27
74 0.24
75 0.19
76 0.17
77 0.15
78 0.09
79 0.11
80 0.19
81 0.23
82 0.23
83 0.23
84 0.25
85 0.28
86 0.33
87 0.36
88 0.34
89 0.39
90 0.48
91 0.52
92 0.57
93 0.63
94 0.66
95 0.72
96 0.76
97 0.79
98 0.79
99 0.86
100 0.9
101 0.93
102 0.96
103 0.96
104 0.97
105 0.97
106 0.98
107 0.98
108 0.98
109 0.98
110 0.98
111 0.98
112 0.98
113 0.98