Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LFR1

Protein Details
Accession A0A367LFR1    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
54-73GETDGKKKRRRGRGERVGESBasic
107-126EEEVQYRQPHRKGKRMPSGVHydrophilic
NLS Segment(s)
PositionSequence
58-68GKKKRRRGRGE
Subcellular Location(s) nucl 10, cyto_nucl 9, mito 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MGEKRGRQRNNKGESSPVDYESRTLGCSSVSLPTSSTSITTSIHVHDGLRWHGGETDGKKKRRRGRGERVGESEDEPDGVGLNPWFLSCFAKGAFALGGFLLAMSWEEEVQYRQPHRKGKRMPSGVLTVVVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.56
4 0.49
5 0.42
6 0.35
7 0.33
8 0.28
9 0.25
10 0.18
11 0.16
12 0.13
13 0.11
14 0.11
15 0.11
16 0.13
17 0.13
18 0.12
19 0.13
20 0.13
21 0.14
22 0.14
23 0.13
24 0.1
25 0.1
26 0.11
27 0.12
28 0.12
29 0.12
30 0.13
31 0.13
32 0.12
33 0.12
34 0.14
35 0.14
36 0.14
37 0.13
38 0.12
39 0.12
40 0.13
41 0.16
42 0.17
43 0.26
44 0.31
45 0.38
46 0.43
47 0.51
48 0.58
49 0.65
50 0.72
51 0.72
52 0.76
53 0.8
54 0.82
55 0.79
56 0.74
57 0.66
58 0.56
59 0.46
60 0.36
61 0.25
62 0.17
63 0.12
64 0.08
65 0.06
66 0.06
67 0.05
68 0.04
69 0.05
70 0.04
71 0.05
72 0.05
73 0.06
74 0.08
75 0.07
76 0.09
77 0.09
78 0.1
79 0.1
80 0.11
81 0.1
82 0.08
83 0.08
84 0.06
85 0.06
86 0.05
87 0.05
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.06
96 0.09
97 0.13
98 0.19
99 0.25
100 0.33
101 0.4
102 0.5
103 0.57
104 0.65
105 0.71
106 0.75
107 0.8
108 0.79
109 0.76
110 0.72
111 0.7
112 0.61