Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367L265

Protein Details
Accession A0A367L265    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
26-51LITLKGYTSKKKKRNHVIKVRKANANHydrophilic
NLS Segment(s)
PositionSequence
35-47KKKKRNHVIKVRK
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences CLLKSVGKKGPNKVICIPSQRAEPGLITLKGYTSKKKKRNHVIKVRKANANNSSKYFSRYFKVPTCSTLTYLYVRTLPRCKRCAQGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.59
4 0.55
5 0.47
6 0.46
7 0.42
8 0.36
9 0.31
10 0.26
11 0.22
12 0.23
13 0.2
14 0.17
15 0.16
16 0.16
17 0.2
18 0.22
19 0.27
20 0.33
21 0.42
22 0.5
23 0.58
24 0.67
25 0.73
26 0.82
27 0.84
28 0.85
29 0.86
30 0.87
31 0.89
32 0.84
33 0.79
34 0.7
35 0.67
36 0.64
37 0.6
38 0.53
39 0.45
40 0.44
41 0.39
42 0.41
43 0.38
44 0.31
45 0.27
46 0.28
47 0.31
48 0.33
49 0.39
50 0.36
51 0.37
52 0.41
53 0.39
54 0.38
55 0.35
56 0.31
57 0.28
58 0.28
59 0.26
60 0.24
61 0.25
62 0.29
63 0.36
64 0.43
65 0.49
66 0.52
67 0.54
68 0.58