Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LRV7

Protein Details
Accession A0A367LRV7    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
222-242SKSYHDQCRKRRNPAVRKQGLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 3, nucl 2, plas 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036412  HAD-like_sf  
IPR023214  HAD_sf  
IPR027706  PGP_Pase  
IPR010021  PGPP1/Gep4  
Gene Ontology GO:0008962  F:phosphatidylglycerophosphatase activity  
Pfam View protein in Pfam  
PF09419  PGP_phosphatase  
Amino Acid Sequences MNPNLSASLNVWRLLLKPGLCLPHHTAATFNDLPIPLDAVLRGKASIKAVVLDKDDCFASPNTNQVHEPYKQHFEALKRAYPGRRLLVVSNTAGATSWDGGLRQAAEVEKNTGVFVLAHSAKKPGCGAEIMAYFRNHPETGVTDSSHVAVVGDRLMTDVMLANMMGAWAFWIRDGVAPRMQKSIVVLSDGKRPSRFPYRTGSASSDSHSRQGVKSNSPILFSKSYHDQCRKRRNPAVRKQGLSSTYLRTKRSMGGKTWSRDEELLFWRIIVPVSPKAAVDTGLRHTWAECATKMKLHFEGLGKRPRRKYTKLMLFEHYYQNVETGHKSPHGRDLVAEHKWHLALHGKTTDVVEPVRRTQARRIRASNLPRPVAHQRLRRRLHSAPGAEASPFLGAATPQQGEGGEEGPHSYPPLLQPGSVYYNSQGTGYRAGGTEDSGYGSMASSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.21
4 0.22
5 0.26
6 0.32
7 0.32
8 0.37
9 0.39
10 0.41
11 0.42
12 0.38
13 0.36
14 0.32
15 0.39
16 0.34
17 0.28
18 0.24
19 0.23
20 0.25
21 0.22
22 0.23
23 0.15
24 0.14
25 0.15
26 0.14
27 0.15
28 0.14
29 0.15
30 0.14
31 0.17
32 0.18
33 0.2
34 0.19
35 0.21
36 0.23
37 0.26
38 0.27
39 0.26
40 0.25
41 0.23
42 0.23
43 0.19
44 0.19
45 0.17
46 0.18
47 0.17
48 0.24
49 0.25
50 0.27
51 0.28
52 0.28
53 0.33
54 0.32
55 0.37
56 0.36
57 0.4
58 0.38
59 0.41
60 0.42
61 0.4
62 0.46
63 0.46
64 0.45
65 0.42
66 0.47
67 0.48
68 0.49
69 0.51
70 0.46
71 0.44
72 0.41
73 0.4
74 0.4
75 0.39
76 0.34
77 0.29
78 0.25
79 0.21
80 0.19
81 0.16
82 0.12
83 0.09
84 0.09
85 0.08
86 0.08
87 0.09
88 0.1
89 0.1
90 0.08
91 0.09
92 0.1
93 0.12
94 0.13
95 0.15
96 0.15
97 0.14
98 0.14
99 0.12
100 0.12
101 0.09
102 0.09
103 0.12
104 0.14
105 0.15
106 0.16
107 0.2
108 0.19
109 0.21
110 0.22
111 0.16
112 0.15
113 0.15
114 0.15
115 0.16
116 0.18
117 0.19
118 0.21
119 0.2
120 0.19
121 0.2
122 0.22
123 0.18
124 0.15
125 0.14
126 0.14
127 0.18
128 0.2
129 0.19
130 0.17
131 0.17
132 0.18
133 0.16
134 0.13
135 0.09
136 0.07
137 0.07
138 0.06
139 0.06
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.03
153 0.02
154 0.03
155 0.03
156 0.03
157 0.03
158 0.04
159 0.04
160 0.07
161 0.1
162 0.12
163 0.17
164 0.19
165 0.2
166 0.22
167 0.21
168 0.19
169 0.18
170 0.19
171 0.14
172 0.15
173 0.16
174 0.15
175 0.22
176 0.24
177 0.25
178 0.23
179 0.24
180 0.26
181 0.35
182 0.36
183 0.31
184 0.36
185 0.39
186 0.4
187 0.42
188 0.4
189 0.33
190 0.32
191 0.3
192 0.28
193 0.24
194 0.24
195 0.22
196 0.2
197 0.18
198 0.24
199 0.26
200 0.24
201 0.26
202 0.3
203 0.29
204 0.29
205 0.29
206 0.26
207 0.25
208 0.22
209 0.22
210 0.24
211 0.27
212 0.33
213 0.41
214 0.45
215 0.53
216 0.64
217 0.68
218 0.69
219 0.73
220 0.77
221 0.79
222 0.81
223 0.82
224 0.78
225 0.73
226 0.65
227 0.62
228 0.53
229 0.45
230 0.38
231 0.31
232 0.32
233 0.34
234 0.34
235 0.31
236 0.31
237 0.33
238 0.38
239 0.37
240 0.32
241 0.37
242 0.42
243 0.43
244 0.46
245 0.41
246 0.36
247 0.33
248 0.3
249 0.27
250 0.23
251 0.23
252 0.18
253 0.17
254 0.16
255 0.15
256 0.15
257 0.11
258 0.11
259 0.11
260 0.13
261 0.13
262 0.13
263 0.13
264 0.14
265 0.14
266 0.12
267 0.12
268 0.14
269 0.15
270 0.15
271 0.14
272 0.14
273 0.15
274 0.16
275 0.16
276 0.14
277 0.17
278 0.17
279 0.21
280 0.22
281 0.23
282 0.22
283 0.21
284 0.23
285 0.24
286 0.31
287 0.34
288 0.43
289 0.46
290 0.52
291 0.58
292 0.63
293 0.67
294 0.66
295 0.68
296 0.7
297 0.74
298 0.74
299 0.72
300 0.67
301 0.64
302 0.61
303 0.56
304 0.47
305 0.37
306 0.29
307 0.26
308 0.22
309 0.2
310 0.19
311 0.16
312 0.17
313 0.21
314 0.23
315 0.23
316 0.3
317 0.31
318 0.29
319 0.28
320 0.31
321 0.33
322 0.35
323 0.34
324 0.27
325 0.26
326 0.27
327 0.25
328 0.22
329 0.23
330 0.21
331 0.25
332 0.25
333 0.24
334 0.24
335 0.26
336 0.25
337 0.19
338 0.2
339 0.2
340 0.21
341 0.24
342 0.32
343 0.34
344 0.36
345 0.44
346 0.51
347 0.54
348 0.59
349 0.61
350 0.59
351 0.65
352 0.71
353 0.7
354 0.69
355 0.65
356 0.57
357 0.58
358 0.6
359 0.61
360 0.6
361 0.6
362 0.62
363 0.69
364 0.75
365 0.74
366 0.73
367 0.68
368 0.69
369 0.69
370 0.61
371 0.55
372 0.52
373 0.47
374 0.39
375 0.35
376 0.26
377 0.17
378 0.14
379 0.09
380 0.07
381 0.06
382 0.08
383 0.12
384 0.12
385 0.11
386 0.12
387 0.12
388 0.13
389 0.14
390 0.13
391 0.1
392 0.1
393 0.12
394 0.12
395 0.13
396 0.13
397 0.12
398 0.12
399 0.14
400 0.22
401 0.21
402 0.21
403 0.21
404 0.25
405 0.3
406 0.29
407 0.29
408 0.22
409 0.24
410 0.25
411 0.24
412 0.22
413 0.18
414 0.22
415 0.21
416 0.21
417 0.19
418 0.21
419 0.2
420 0.2
421 0.19
422 0.15
423 0.16
424 0.14
425 0.14
426 0.12