Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LHR9

Protein Details
Accession A0A367LHR9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRKPMGPKKADPLPTBasic
NLS Segment(s)
PositionSequence
3-16KRKKSSRKPMGPKK
Subcellular Location(s) mito 13, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPMGPKKADPLPTTFTCLFCNHEKSVTVKLDRKAGVGQLDCRVCGQKFQCAVNYLSAAVDVYGEWVDAADAVARQDTSNAGRYSSTAIITGSENASGGTSGTGRDGYGDAPIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.81
4 0.76
5 0.67
6 0.61
7 0.56
8 0.49
9 0.5
10 0.43
11 0.36
12 0.32
13 0.32
14 0.31
15 0.29
16 0.32
17 0.27
18 0.28
19 0.28
20 0.28
21 0.34
22 0.35
23 0.35
24 0.36
25 0.37
26 0.41
27 0.4
28 0.38
29 0.32
30 0.29
31 0.28
32 0.24
33 0.24
34 0.23
35 0.22
36 0.21
37 0.21
38 0.21
39 0.17
40 0.2
41 0.19
42 0.19
43 0.22
44 0.23
45 0.24
46 0.24
47 0.25
48 0.21
49 0.2
50 0.15
51 0.12
52 0.11
53 0.08
54 0.06
55 0.05
56 0.03
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.05
70 0.05
71 0.05
72 0.07
73 0.09
74 0.15
75 0.15
76 0.16
77 0.16
78 0.16
79 0.2
80 0.2
81 0.18
82 0.12
83 0.12
84 0.13
85 0.13
86 0.14
87 0.11
88 0.1
89 0.09
90 0.09
91 0.09
92 0.08
93 0.07
94 0.06
95 0.06
96 0.06
97 0.08
98 0.08
99 0.08
100 0.09
101 0.1
102 0.09