Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LDU3

Protein Details
Accession A0A367LDU3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSPERIYKKSFNKANKKTIAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MSPERIYKKSFNKANKKTIAPNPVLTKDKLYSLTNRERNRYALGFYSRLIVTAGVQGQDIEASSDAED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.75
4 0.73
5 0.73
6 0.7
7 0.62
8 0.58
9 0.53
10 0.52
11 0.5
12 0.43
13 0.38
14 0.31
15 0.3
16 0.28
17 0.24
18 0.23
19 0.27
20 0.35
21 0.4
22 0.42
23 0.44
24 0.42
25 0.43
26 0.43
27 0.37
28 0.29
29 0.27
30 0.28
31 0.25
32 0.23
33 0.25
34 0.2
35 0.2
36 0.18
37 0.13
38 0.1
39 0.12
40 0.13
41 0.1
42 0.11
43 0.1
44 0.1
45 0.1
46 0.09
47 0.08
48 0.07