Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367L968

Protein Details
Accession A0A367L968    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-32EGDYVIEKKKRNHKVRKADADNSSKHydrophilic
NLS Segment(s)
PositionSequence
15-23KKKRNHKVR
Subcellular Location(s) nucl 18, cyto 6, mito 1, pero 1, vacu 1
Family & Domain DBs
Amino Acid Sequences DEELTNREGDYVIEKKKRNHKVRKADADNSSKYFSRYFKVPTCSTLTYLYKIGDLEEDLYVPYPAVSAVLRGVWVRIRPYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.46
3 0.56
4 0.66
5 0.71
6 0.76
7 0.78
8 0.82
9 0.88
10 0.91
11 0.88
12 0.85
13 0.82
14 0.77
15 0.7
16 0.62
17 0.54
18 0.43
19 0.37
20 0.33
21 0.27
22 0.22
23 0.22
24 0.24
25 0.26
26 0.31
27 0.31
28 0.3
29 0.34
30 0.32
31 0.31
32 0.31
33 0.28
34 0.24
35 0.25
36 0.22
37 0.17
38 0.16
39 0.15
40 0.11
41 0.1
42 0.09
43 0.08
44 0.08
45 0.07
46 0.08
47 0.08
48 0.07
49 0.06
50 0.05
51 0.05
52 0.06
53 0.05
54 0.06
55 0.07
56 0.07
57 0.08
58 0.09
59 0.11
60 0.14
61 0.17