Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LG86

Protein Details
Accession A0A367LG86    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-36KFFPEEKRPTSPKRIYKKSFNKANKKTIAPHydrophilic
NLS Segment(s)
PositionSequence
19-24KRIYKK
Subcellular Location(s) nucl 14, cyto_nucl 11.5, cyto 7, mito 6
Family & Domain DBs
Amino Acid Sequences GYKEAVKFFPEEKRPTSPKRIYKKSFNKANKKTIAPNPVLTKVDDLIKQLRILILIDRKAPRKTLSSRQLTFIVDLTLNFGKISLKSPIMLALLDTSAETNILTTSTARNLNLEYCPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.68
4 0.68
5 0.7
6 0.75
7 0.8
8 0.79
9 0.82
10 0.86
11 0.85
12 0.86
13 0.87
14 0.87
15 0.85
16 0.88
17 0.83
18 0.76
19 0.74
20 0.71
21 0.68
22 0.6
23 0.56
24 0.51
25 0.48
26 0.45
27 0.38
28 0.32
29 0.25
30 0.25
31 0.21
32 0.19
33 0.17
34 0.17
35 0.17
36 0.16
37 0.15
38 0.12
39 0.12
40 0.12
41 0.13
42 0.13
43 0.17
44 0.2
45 0.23
46 0.24
47 0.25
48 0.24
49 0.26
50 0.31
51 0.36
52 0.43
53 0.47
54 0.48
55 0.49
56 0.49
57 0.43
58 0.39
59 0.29
60 0.21
61 0.13
62 0.12
63 0.13
64 0.11
65 0.11
66 0.1
67 0.09
68 0.09
69 0.1
70 0.13
71 0.12
72 0.13
73 0.13
74 0.13
75 0.15
76 0.15
77 0.14
78 0.11
79 0.09
80 0.08
81 0.08
82 0.08
83 0.07
84 0.06
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.06
91 0.07
92 0.09
93 0.13
94 0.17
95 0.17
96 0.18
97 0.2
98 0.22