Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L8I4

Protein Details
Accession A0A367L8I4   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-46LITSKGYTSKKKKRNHVIKVRKADADHydrophilic
NLS Segment(s)
PositionSequence
30-39KKKKRNHVIK
Subcellular Location(s) nucl 16.5, mito_nucl 12.166, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MAERGNFFKKSIPSQRAEPGLITSKGYTSKKKKRNHVIKVRKADADDSSKYFSRYFKVPTCSTLTYLYKIGDLEEDLYVPYPAVSAVLRGVWVRIRPFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.58
3 0.56
4 0.52
5 0.43
6 0.37
7 0.36
8 0.33
9 0.29
10 0.23
11 0.21
12 0.27
13 0.29
14 0.35
15 0.4
16 0.49
17 0.57
18 0.65
19 0.73
20 0.78
21 0.85
22 0.86
23 0.87
24 0.88
25 0.89
26 0.89
27 0.82
28 0.72
29 0.62
30 0.54
31 0.46
32 0.4
33 0.32
34 0.25
35 0.25
36 0.24
37 0.24
38 0.23
39 0.2
40 0.17
41 0.19
42 0.22
43 0.24
44 0.29
45 0.29
46 0.31
47 0.35
48 0.34
49 0.33
50 0.34
51 0.3
52 0.26
53 0.27
54 0.24
55 0.19
56 0.18
57 0.16
58 0.12
59 0.11
60 0.1
61 0.09
62 0.09
63 0.08
64 0.09
65 0.08
66 0.07
67 0.07
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.07
74 0.07
75 0.09
76 0.09
77 0.11
78 0.14
79 0.18