Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367L993

Protein Details
Accession A0A367L993    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-50EGDHVIEKKKRNHKVRKADANNSSKBasic
NLS Segment(s)
PositionSequence
33-42KKKRNHKVRK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences KSPIFRGYKKTQKVIQAVDKELTNREGDHVIEKKKRNHKVRKADANNSSKYFSRYFKVPTCSTLTYLYKIGDLEEDLYVPYPAVSAVLRGVWVRIRPYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.68
3 0.63
4 0.59
5 0.53
6 0.48
7 0.41
8 0.37
9 0.31
10 0.23
11 0.18
12 0.17
13 0.16
14 0.15
15 0.21
16 0.24
17 0.29
18 0.35
19 0.41
20 0.48
21 0.56
22 0.65
23 0.69
24 0.75
25 0.78
26 0.82
27 0.86
28 0.88
29 0.86
30 0.84
31 0.82
32 0.77
33 0.7
34 0.61
35 0.52
36 0.42
37 0.38
38 0.33
39 0.26
40 0.22
41 0.22
42 0.25
43 0.28
44 0.33
45 0.31
46 0.31
47 0.35
48 0.34
49 0.33
50 0.34
51 0.3
52 0.26
53 0.27
54 0.24
55 0.19
56 0.18
57 0.16
58 0.12
59 0.11
60 0.1
61 0.09
62 0.09
63 0.08
64 0.09
65 0.08
66 0.07
67 0.07
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.07
74 0.07
75 0.09
76 0.09
77 0.11
78 0.14
79 0.17