Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L5E1

Protein Details
Accession A0A367L5E1   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MFCSRVQTILQRRRKQKRTVQITRRPSWPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 8, cyto_nucl 7.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MFCSRVQTILQRRRKQKRTVQITRRPSWPSSSNNSPPLLPSRFSLVQNVLLLLLHHPRRWIVVAPDRHHPANREKEKQHGWREENHHHPSFPAFFLPPPFTPSHSFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.86
4 0.87
5 0.87
6 0.89
7 0.89
8 0.88
9 0.89
10 0.84
11 0.79
12 0.73
13 0.64
14 0.59
15 0.54
16 0.5
17 0.48
18 0.52
19 0.51
20 0.51
21 0.5
22 0.43
23 0.39
24 0.4
25 0.34
26 0.26
27 0.21
28 0.24
29 0.25
30 0.26
31 0.26
32 0.22
33 0.22
34 0.2
35 0.2
36 0.13
37 0.11
38 0.1
39 0.09
40 0.12
41 0.11
42 0.11
43 0.12
44 0.12
45 0.13
46 0.14
47 0.15
48 0.16
49 0.23
50 0.3
51 0.31
52 0.37
53 0.39
54 0.4
55 0.4
56 0.38
57 0.39
58 0.43
59 0.49
60 0.51
61 0.49
62 0.56
63 0.63
64 0.68
65 0.69
66 0.67
67 0.62
68 0.62
69 0.69
70 0.69
71 0.7
72 0.68
73 0.61
74 0.52
75 0.5
76 0.46
77 0.41
78 0.34
79 0.27
80 0.21
81 0.21
82 0.25
83 0.29
84 0.26
85 0.28
86 0.29
87 0.3