Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LPM4

Protein Details
Accession A0A367LPM4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-36YVGRGRERGRERERQRERQRETERDRETBasic
NLS Segment(s)
PositionSequence
14-24RERGRERERQR
Subcellular Location(s) mito 9, extr 5, cyto_mito 5, nucl 4, golg 3
Family & Domain DBs
Amino Acid Sequences MSIHSLSLYVGRGRERGRERERQRERQRETERDRETENQPDDWKGSYSLNRERGAGDVSVLIEVSLSCMVLSLSFFLYHYPEEWTDETGPFHGKTTTTNITREYINNQVGEGNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.45
4 0.5
5 0.58
6 0.64
7 0.7
8 0.78
9 0.8
10 0.85
11 0.85
12 0.84
13 0.84
14 0.85
15 0.84
16 0.82
17 0.81
18 0.75
19 0.67
20 0.64
21 0.58
22 0.53
23 0.51
24 0.46
25 0.38
26 0.35
27 0.34
28 0.31
29 0.27
30 0.24
31 0.17
32 0.17
33 0.18
34 0.22
35 0.28
36 0.32
37 0.32
38 0.31
39 0.3
40 0.28
41 0.26
42 0.2
43 0.14
44 0.08
45 0.08
46 0.07
47 0.06
48 0.05
49 0.03
50 0.03
51 0.04
52 0.04
53 0.03
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.06
64 0.08
65 0.08
66 0.09
67 0.11
68 0.11
69 0.14
70 0.15
71 0.18
72 0.18
73 0.18
74 0.19
75 0.17
76 0.19
77 0.16
78 0.17
79 0.15
80 0.14
81 0.15
82 0.22
83 0.28
84 0.29
85 0.3
86 0.32
87 0.32
88 0.34
89 0.34
90 0.32
91 0.32
92 0.33
93 0.31
94 0.29