Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367L8H6

Protein Details
Accession A0A367L8H6    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-30NREGDHVIEKKKRNHKVRKANADNSSKYHydrophilic
NLS Segment(s)
PositionSequence
12-21KKKRNHKVRK
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences LTNREGDHVIEKKKRNHKVRKANADNSSKYFSRYFKVPTCSTLTYLYKIGDLEEDLYVPYPAISAVLRGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.8
4 0.83
5 0.86
6 0.89
7 0.91
8 0.9
9 0.88
10 0.86
11 0.82
12 0.74
13 0.66
14 0.6
15 0.49
16 0.43
17 0.37
18 0.3
19 0.25
20 0.25
21 0.26
22 0.27
23 0.32
24 0.3
25 0.3
26 0.34
27 0.33
28 0.32
29 0.32
30 0.29
31 0.26
32 0.26
33 0.23
34 0.19
35 0.18
36 0.16
37 0.12
38 0.11
39 0.1
40 0.09
41 0.09
42 0.08
43 0.09
44 0.09
45 0.08
46 0.07
47 0.05
48 0.05
49 0.06
50 0.06