Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LIV7

Protein Details
Accession A0A367LIV7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
56-75RPYRRFCNPMRPGRNCPRPPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, cyto 4.5, extr 4, mito 3
Family & Domain DBs
Amino Acid Sequences MAPSAAPPDRAPGDTIGVLIIRCGRSFRSAPPLLLRRTRPPFLLLLPVQSRNPSNRPYRRFCNPMRPGRNCPRPPYLLPPLPHYPRDYLSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.15
4 0.13
5 0.12
6 0.11
7 0.13
8 0.1
9 0.11
10 0.12
11 0.13
12 0.17
13 0.19
14 0.22
15 0.28
16 0.29
17 0.3
18 0.36
19 0.41
20 0.4
21 0.44
22 0.44
23 0.43
24 0.47
25 0.48
26 0.41
27 0.37
28 0.35
29 0.3
30 0.32
31 0.24
32 0.22
33 0.22
34 0.22
35 0.21
36 0.21
37 0.21
38 0.2
39 0.23
40 0.25
41 0.33
42 0.4
43 0.47
44 0.52
45 0.57
46 0.6
47 0.64
48 0.64
49 0.65
50 0.65
51 0.69
52 0.72
53 0.73
54 0.74
55 0.77
56 0.83
57 0.77
58 0.74
59 0.7
60 0.67
61 0.64
62 0.64
63 0.63
64 0.59
65 0.55
66 0.56
67 0.58
68 0.57
69 0.56
70 0.51
71 0.46
72 0.42