Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LN05

Protein Details
Accession A0A367LN05    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-36SLSLSRYRVRRWARRRTRDGDGSTHydrophilic
NLS Segment(s)
PositionSequence
22-30RRWARRRTR
42-54ENKRRHSRMSSGR
Subcellular Location(s) mito 24, nucl 1, cyto 1, plas 1, cyto_nucl 1
Family & Domain DBs
Amino Acid Sequences MGDGRGGVAINLSLSLSRYRVRRWARRRTRDGDGSTGHVRVENKRRHSRMSSGRRSLVWEKRANRQRELQAEVMSGWVVWEVRVSPATTKLRYRQGPARFPPALEPSGVGGRGGPARAAWFPKQRGQRVQCWSASLRTELCLGLRTVDWGYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.11
4 0.15
5 0.19
6 0.22
7 0.32
8 0.42
9 0.51
10 0.59
11 0.68
12 0.75
13 0.82
14 0.88
15 0.85
16 0.84
17 0.82
18 0.75
19 0.7
20 0.61
21 0.55
22 0.48
23 0.42
24 0.33
25 0.27
26 0.26
27 0.28
28 0.36
29 0.38
30 0.45
31 0.55
32 0.58
33 0.61
34 0.64
35 0.65
36 0.66
37 0.69
38 0.69
39 0.64
40 0.64
41 0.58
42 0.59
43 0.58
44 0.55
45 0.51
46 0.49
47 0.47
48 0.54
49 0.62
50 0.6
51 0.55
52 0.54
53 0.53
54 0.5
55 0.51
56 0.43
57 0.36
58 0.32
59 0.28
60 0.22
61 0.16
62 0.11
63 0.06
64 0.05
65 0.04
66 0.03
67 0.03
68 0.04
69 0.05
70 0.06
71 0.06
72 0.07
73 0.14
74 0.18
75 0.2
76 0.24
77 0.28
78 0.35
79 0.37
80 0.41
81 0.42
82 0.47
83 0.53
84 0.53
85 0.56
86 0.48
87 0.47
88 0.46
89 0.42
90 0.35
91 0.26
92 0.23
93 0.17
94 0.18
95 0.18
96 0.13
97 0.09
98 0.1
99 0.11
100 0.11
101 0.09
102 0.07
103 0.1
104 0.13
105 0.17
106 0.22
107 0.29
108 0.32
109 0.39
110 0.48
111 0.53
112 0.61
113 0.62
114 0.65
115 0.65
116 0.67
117 0.61
118 0.57
119 0.52
120 0.47
121 0.44
122 0.38
123 0.31
124 0.26
125 0.26
126 0.22
127 0.21
128 0.18
129 0.16
130 0.15
131 0.14
132 0.16