Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LPE3

Protein Details
Accession A0A367LPE3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-106NPITRRPGPGRGRPRKQSSPVPAHydrophilic
NLS Segment(s)
PositionSequence
89-99RPGPGRGRPRK
Subcellular Location(s) cyto 13, mito 8, nucl 5
Family & Domain DBs
Amino Acid Sequences MSSKNWNDRADKDLFFTILSVKNIGVISGAEWTTIGNHMRSLGYGFTNEGCRQHFQGLRRAQNKADTNGIVSETASRRVDPTLNPITRRPGPGRGRPRKQSSPVPADDAPVMSGSAPAPGSASVHVSVPVPVPVPVPVSFSGAIPGPYFGAVPAQVSPSVISPAMSHPRPSQEEPSTPTAEKAAAADVVPPPPSVPAATAAVATTTIDSPRPPMMPPDPTAPDVVGDEADLDAESTIPLADQMGSTDEPPLKRQKMEPQDADSEPLDEEAVLALAAHNGSTGPDPYGSEFLVDLVCALHEVAALSPAAKVAIEEFLRNEGHDTSWNAIRRQVMRWTPEVDQRILLAMFQHVTMTAGDWDNVMSELRGDGYNFSESALRSAASSVYPVVVRLFQPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.26
4 0.25
5 0.24
6 0.24
7 0.21
8 0.19
9 0.21
10 0.21
11 0.2
12 0.16
13 0.11
14 0.1
15 0.13
16 0.13
17 0.1
18 0.1
19 0.1
20 0.1
21 0.14
22 0.16
23 0.13
24 0.14
25 0.15
26 0.16
27 0.16
28 0.17
29 0.15
30 0.14
31 0.14
32 0.15
33 0.15
34 0.2
35 0.22
36 0.23
37 0.24
38 0.26
39 0.28
40 0.34
41 0.37
42 0.36
43 0.43
44 0.49
45 0.56
46 0.58
47 0.58
48 0.54
49 0.58
50 0.59
51 0.53
52 0.49
53 0.4
54 0.37
55 0.34
56 0.33
57 0.24
58 0.19
59 0.21
60 0.18
61 0.22
62 0.21
63 0.2
64 0.21
65 0.23
66 0.26
67 0.22
68 0.28
69 0.33
70 0.36
71 0.39
72 0.4
73 0.45
74 0.46
75 0.5
76 0.46
77 0.46
78 0.5
79 0.58
80 0.66
81 0.7
82 0.75
83 0.78
84 0.83
85 0.82
86 0.81
87 0.8
88 0.78
89 0.76
90 0.69
91 0.65
92 0.57
93 0.49
94 0.43
95 0.34
96 0.25
97 0.16
98 0.14
99 0.08
100 0.08
101 0.07
102 0.08
103 0.07
104 0.07
105 0.07
106 0.07
107 0.08
108 0.08
109 0.1
110 0.08
111 0.09
112 0.09
113 0.09
114 0.1
115 0.1
116 0.1
117 0.09
118 0.09
119 0.09
120 0.09
121 0.11
122 0.11
123 0.13
124 0.13
125 0.15
126 0.15
127 0.14
128 0.15
129 0.12
130 0.13
131 0.1
132 0.1
133 0.07
134 0.07
135 0.07
136 0.06
137 0.06
138 0.05
139 0.06
140 0.06
141 0.07
142 0.07
143 0.07
144 0.08
145 0.07
146 0.08
147 0.08
148 0.07
149 0.07
150 0.11
151 0.17
152 0.17
153 0.19
154 0.19
155 0.24
156 0.28
157 0.3
158 0.33
159 0.31
160 0.33
161 0.35
162 0.38
163 0.36
164 0.32
165 0.29
166 0.23
167 0.2
168 0.17
169 0.13
170 0.09
171 0.07
172 0.06
173 0.08
174 0.08
175 0.08
176 0.09
177 0.08
178 0.08
179 0.08
180 0.08
181 0.07
182 0.06
183 0.07
184 0.08
185 0.08
186 0.08
187 0.07
188 0.07
189 0.07
190 0.06
191 0.05
192 0.04
193 0.05
194 0.05
195 0.05
196 0.07
197 0.09
198 0.1
199 0.1
200 0.14
201 0.17
202 0.19
203 0.21
204 0.24
205 0.24
206 0.24
207 0.25
208 0.2
209 0.18
210 0.15
211 0.13
212 0.08
213 0.06
214 0.05
215 0.04
216 0.04
217 0.04
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.04
230 0.06
231 0.07
232 0.07
233 0.1
234 0.12
235 0.13
236 0.16
237 0.24
238 0.24
239 0.26
240 0.3
241 0.37
242 0.44
243 0.52
244 0.52
245 0.48
246 0.51
247 0.5
248 0.48
249 0.39
250 0.3
251 0.22
252 0.18
253 0.14
254 0.08
255 0.08
256 0.05
257 0.05
258 0.03
259 0.03
260 0.03
261 0.04
262 0.04
263 0.03
264 0.03
265 0.03
266 0.04
267 0.06
268 0.06
269 0.07
270 0.07
271 0.08
272 0.1
273 0.12
274 0.11
275 0.11
276 0.1
277 0.1
278 0.09
279 0.08
280 0.06
281 0.05
282 0.05
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.04
289 0.05
290 0.05
291 0.05
292 0.05
293 0.06
294 0.05
295 0.05
296 0.05
297 0.05
298 0.1
299 0.11
300 0.11
301 0.12
302 0.16
303 0.16
304 0.16
305 0.17
306 0.13
307 0.14
308 0.17
309 0.18
310 0.19
311 0.25
312 0.29
313 0.28
314 0.3
315 0.34
316 0.33
317 0.36
318 0.41
319 0.42
320 0.42
321 0.45
322 0.46
323 0.44
324 0.49
325 0.49
326 0.41
327 0.35
328 0.31
329 0.3
330 0.26
331 0.22
332 0.15
333 0.13
334 0.12
335 0.11
336 0.11
337 0.08
338 0.09
339 0.09
340 0.1
341 0.11
342 0.11
343 0.11
344 0.11
345 0.11
346 0.11
347 0.11
348 0.1
349 0.07
350 0.07
351 0.07
352 0.09
353 0.1
354 0.1
355 0.11
356 0.13
357 0.15
358 0.15
359 0.15
360 0.17
361 0.16
362 0.18
363 0.17
364 0.15
365 0.13
366 0.14
367 0.15
368 0.12
369 0.13
370 0.11
371 0.13
372 0.13
373 0.13
374 0.14
375 0.16