Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1D3X6

Protein Details
Accession A1D3X6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
193-217QMLDLSKKQRKERIRRRQLQYTTFGHydrophilic
NLS Segment(s)
PositionSequence
200-208KQRKERIRR
Subcellular Location(s) plas 21, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG nfi:NFIA_018200  -  
Pfam View protein in Pfam  
PF07264  EI24  
Amino Acid Sequences MDRPGMNRLWDPSKAAWLYPLRGIYYFASHRFLWPLFRARLISIVLLSTFILFILFLFTYLPQVAFLAIFQGAGAWVNGAFLVLGEGAAIVALLFEAFFVDETLVDIFDAVLVNEGHGELVTACRVLYPQGDDVLKRLGKPTHSAVYSPFSLRQIIEFILFLPLNFIPVAGTPMFLLLTGYRAGPFHHWRYFQMLDLSKKQRKERIRRRQLQYTTFGTVALLLQLIPGLSMLFLMSTAAGSALWVRDIENKRDALRGRHDGMSNEYPDDDNII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.36
4 0.34
5 0.35
6 0.35
7 0.36
8 0.29
9 0.29
10 0.31
11 0.25
12 0.28
13 0.29
14 0.27
15 0.29
16 0.27
17 0.29
18 0.3
19 0.3
20 0.28
21 0.29
22 0.35
23 0.33
24 0.35
25 0.35
26 0.32
27 0.34
28 0.3
29 0.25
30 0.18
31 0.16
32 0.13
33 0.12
34 0.11
35 0.08
36 0.07
37 0.06
38 0.05
39 0.04
40 0.04
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.09
47 0.09
48 0.09
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.05
61 0.05
62 0.04
63 0.03
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.03
98 0.05
99 0.04
100 0.04
101 0.05
102 0.05
103 0.04
104 0.04
105 0.04
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.06
115 0.07
116 0.07
117 0.1
118 0.11
119 0.11
120 0.12
121 0.16
122 0.15
123 0.14
124 0.16
125 0.15
126 0.16
127 0.19
128 0.22
129 0.21
130 0.21
131 0.21
132 0.2
133 0.22
134 0.22
135 0.2
136 0.18
137 0.14
138 0.15
139 0.14
140 0.13
141 0.11
142 0.11
143 0.1
144 0.09
145 0.08
146 0.1
147 0.09
148 0.08
149 0.09
150 0.08
151 0.09
152 0.09
153 0.08
154 0.06
155 0.06
156 0.09
157 0.07
158 0.07
159 0.06
160 0.07
161 0.07
162 0.06
163 0.07
164 0.04
165 0.06
166 0.06
167 0.06
168 0.07
169 0.07
170 0.08
171 0.14
172 0.2
173 0.25
174 0.29
175 0.3
176 0.31
177 0.38
178 0.38
179 0.34
180 0.35
181 0.34
182 0.34
183 0.41
184 0.48
185 0.47
186 0.52
187 0.56
188 0.58
189 0.63
190 0.7
191 0.73
192 0.75
193 0.82
194 0.86
195 0.88
196 0.9
197 0.87
198 0.82
199 0.77
200 0.7
201 0.62
202 0.52
203 0.44
204 0.33
205 0.26
206 0.19
207 0.13
208 0.08
209 0.05
210 0.04
211 0.05
212 0.04
213 0.04
214 0.04
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.04
222 0.04
223 0.03
224 0.04
225 0.04
226 0.04
227 0.04
228 0.06
229 0.06
230 0.07
231 0.07
232 0.08
233 0.17
234 0.23
235 0.28
236 0.31
237 0.34
238 0.35
239 0.41
240 0.44
241 0.43
242 0.47
243 0.49
244 0.48
245 0.51
246 0.52
247 0.48
248 0.52
249 0.51
250 0.44
251 0.38
252 0.35
253 0.3