Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LES8

Protein Details
Accession A0A367LES8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-44TTPFIRRAARRRQQSRPAAAAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 4, extr 4, E.R. 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018908  TMEM234  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10639  TMEM234  
Amino Acid Sequences MASPPPAINYILSFVLVGLAWGLTTPFIRRAARRRQQSRPAAAAAATAEDESSSSMKNRLWSACVSVWDFVRDPSYSLPLLLNLSGSLWFFLLVGRAASNPRFRPSGLGFLLVELSLTVPIVNTLAFLFTVLGEWFVEGKVISKRTASGVVLSLAGIALCVHSKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.08
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.06
12 0.07
13 0.11
14 0.16
15 0.2
16 0.27
17 0.36
18 0.46
19 0.54
20 0.63
21 0.68
22 0.73
23 0.79
24 0.82
25 0.8
26 0.73
27 0.66
28 0.56
29 0.47
30 0.38
31 0.28
32 0.19
33 0.13
34 0.08
35 0.06
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.09
43 0.11
44 0.14
45 0.17
46 0.16
47 0.18
48 0.18
49 0.22
50 0.21
51 0.22
52 0.2
53 0.19
54 0.18
55 0.18
56 0.17
57 0.13
58 0.13
59 0.11
60 0.11
61 0.11
62 0.13
63 0.11
64 0.11
65 0.11
66 0.09
67 0.1
68 0.09
69 0.08
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.04
81 0.05
82 0.05
83 0.05
84 0.07
85 0.1
86 0.16
87 0.17
88 0.19
89 0.2
90 0.2
91 0.25
92 0.25
93 0.3
94 0.25
95 0.25
96 0.23
97 0.22
98 0.22
99 0.16
100 0.14
101 0.06
102 0.06
103 0.04
104 0.04
105 0.04
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.07
123 0.06
124 0.07
125 0.06
126 0.09
127 0.14
128 0.16
129 0.17
130 0.17
131 0.19
132 0.21
133 0.25
134 0.23
135 0.2
136 0.2
137 0.19
138 0.19
139 0.17
140 0.14
141 0.1
142 0.09
143 0.07
144 0.05
145 0.05