Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367L7H1

Protein Details
Accession A0A367L7H1    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-83NRPYRRFCNPMRPGRNRPRPPCSLPPLPRRPRDHLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLRRGNARPSYILCIDSAFIFIGPPLQPRRTRPPFPPLSPVQSRNPLNRPYRRFCNPMRPGRNRPRPPCSLPPLPRRPRDHLSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.19
4 0.16
5 0.1
6 0.08
7 0.07
8 0.07
9 0.08
10 0.08
11 0.13
12 0.16
13 0.21
14 0.25
15 0.31
16 0.42
17 0.47
18 0.51
19 0.52
20 0.57
21 0.59
22 0.58
23 0.59
24 0.51
25 0.5
26 0.49
27 0.48
28 0.42
29 0.42
30 0.42
31 0.41
32 0.44
33 0.45
34 0.49
35 0.53
36 0.56
37 0.55
38 0.6
39 0.61
40 0.61
41 0.59
42 0.61
43 0.62
44 0.66
45 0.7
46 0.71
47 0.75
48 0.81
49 0.87
50 0.86
51 0.85
52 0.82
53 0.8
54 0.79
55 0.79
56 0.76
57 0.75
58 0.74
59 0.76
60 0.79
61 0.81
62 0.82
63 0.8
64 0.8
65 0.77