Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L015

Protein Details
Accession A0A367L015   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
113-133GYRVANRPKQHRSLPRLQYNVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 7, mito_nucl 7
Family & Domain DBs
Amino Acid Sequences MPRTGRLKGVPPKGRSIKKIVVVLELIETLLDFCMIDIPANATSARRRTGASSPASYSGRPANVMLAWTFNAESECEMRSIISTFIHEKPRLKQNKNLLKTVQTNKCLSHGGGYRVANRPKQHRSLPRLQYNVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.69
3 0.68
4 0.65
5 0.62
6 0.64
7 0.55
8 0.48
9 0.41
10 0.36
11 0.29
12 0.22
13 0.15
14 0.1
15 0.09
16 0.06
17 0.05
18 0.05
19 0.03
20 0.03
21 0.05
22 0.05
23 0.06
24 0.05
25 0.08
26 0.08
27 0.09
28 0.09
29 0.09
30 0.13
31 0.16
32 0.18
33 0.17
34 0.17
35 0.2
36 0.25
37 0.3
38 0.3
39 0.29
40 0.28
41 0.31
42 0.32
43 0.28
44 0.25
45 0.21
46 0.17
47 0.16
48 0.14
49 0.11
50 0.1
51 0.11
52 0.09
53 0.08
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.08
68 0.08
69 0.07
70 0.08
71 0.12
72 0.16
73 0.22
74 0.24
75 0.27
76 0.32
77 0.41
78 0.49
79 0.5
80 0.53
81 0.58
82 0.66
83 0.67
84 0.67
85 0.59
86 0.56
87 0.6
88 0.62
89 0.6
90 0.54
91 0.52
92 0.48
93 0.48
94 0.44
95 0.36
96 0.33
97 0.3
98 0.29
99 0.33
100 0.34
101 0.37
102 0.43
103 0.49
104 0.48
105 0.51
106 0.56
107 0.58
108 0.63
109 0.68
110 0.7
111 0.73
112 0.77
113 0.81
114 0.81