FuNGI

A0A367LJB3

Protein Details

Accession

A0A367LJB3

Localization Confidence

Low

Confidence Score

9.6

NoLS Segment(s)

Position	Sequence	Protein Nature
121-150	AMEESRQRKIRHQRSREKRRFNDYLRRQTA	Hydrophilic

NLS Segment(s)

Position	Sequence
127-140	QRKIRHQRSREKRR

Subcellular Location(s)

cyto 14, cyto_nucl 11, mito 7, nucl 6

Family & Domain DBs

InterPro	View protein in InterPro IPR000571 Znf_CCCH IPR036855 Znf_CCCH_sf
Gene Ontology	GO:0046872 F:metal ion binding
PROSITE	View protein in PROSITE PS50103 ZF_C3H1

Amino Acid Sequences

MSDEDKELLARIGQLAGQINRHKSQQATVAPGTQPAPQRLNAYRHSSAPYPRAGYRGGRPALAHRHRTLRLNDPKTRQESDAADGEVSSGGQGKWVSRTDRHRQLINADIYQKDAQNRFKAMEESRQRKIRHQRSREKRRFNDYLRRQTATAASVAESVNEIIIDGMRFRVADGGKKLLKVADDLQSAPSTPKTVDVAGVTFHRTKTGNLVASRVVRDHRYVFRPVDGVKLTAGSRSGVVKKTDQMCRIFSTTGKYLIRRSGPGRLATKRPPFLSPPSPSPPLQPIGSCPKGPRCRYIHDANKVAICREFLKEGKCGDGDSCDLSHEVSPERVPNCVHYAKGHCAKPDCPYTHSKAAPGAAVCEAFGFLGYCEKGSECRDRHVSECPDFSNTGSCKTKGCKLLHREKASVLRAHGKARGEASDDDVSSDEDSACSDDVDSDEVADFVQAETDESDADADGQDFIRV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.14
2	0.19
3	0.2
4	0.26
5	0.31
6	0.36
7	0.38
8	0.41
9	0.41
10	0.38
11	0.4
12	0.42
13	0.41
14	0.43
15	0.42
16	0.44
17	0.4
18	0.41
19	0.38
20	0.34
21	0.34
22	0.33
23	0.34
24	0.32
25	0.39
26	0.43
27	0.48
28	0.49
29	0.52
30	0.49
31	0.49
32	0.5
33	0.49
34	0.49
35	0.47
36	0.46
37	0.42
38	0.41
39	0.41
40	0.4
41	0.4
42	0.4
43	0.45
44	0.41
45	0.38
46	0.38
47	0.43
48	0.5
49	0.53
50	0.53
51	0.49
52	0.55
53	0.57
54	0.63
55	0.61
56	0.61
57	0.63
58	0.65
59	0.69
60	0.68
61	0.72
62	0.71
63	0.7
64	0.61
65	0.55
66	0.49
67	0.45
68	0.42
69	0.34
70	0.28
71	0.24
72	0.22
73	0.17
74	0.13
75	0.09
76	0.07
77	0.06
78	0.09
79	0.1
80	0.1
81	0.15
82	0.2
83	0.24
84	0.29
85	0.38
86	0.45
87	0.55
88	0.58
89	0.58
90	0.56
91	0.56
92	0.58
93	0.53
94	0.47
95	0.4
96	0.35
97	0.35
98	0.35
99	0.32
100	0.3
101	0.32
102	0.35
103	0.36
104	0.38
105	0.36
106	0.36
107	0.39
108	0.36
109	0.4
110	0.43
111	0.44
112	0.5
113	0.56
114	0.56
115	0.6
116	0.69
117	0.7
118	0.71
119	0.75
120	0.78
121	0.82
122	0.92
123	0.93
124	0.93
125	0.89
126	0.87
127	0.86
128	0.84
129	0.83
130	0.82
131	0.83
132	0.77
133	0.71
134	0.63
135	0.55
136	0.49
137	0.39
138	0.3
139	0.2
140	0.15
141	0.14
142	0.14
143	0.12
144	0.1
145	0.08
146	0.07
147	0.06
148	0.05
149	0.04
150	0.04
151	0.04
152	0.04
153	0.04
154	0.05
155	0.05
156	0.05
157	0.09
158	0.1
159	0.14
160	0.16
161	0.22
162	0.23
163	0.24
164	0.24
165	0.21
166	0.2
167	0.18
168	0.19
169	0.18
170	0.18
171	0.18
172	0.19
173	0.18
174	0.18
175	0.16
176	0.14
177	0.1
178	0.09
179	0.1
180	0.1
181	0.1
182	0.11
183	0.1
184	0.1
185	0.1
186	0.11
187	0.12
188	0.12
189	0.12
190	0.13
191	0.13
192	0.13
193	0.18
194	0.22
195	0.24
196	0.23
197	0.24
198	0.24
199	0.25
200	0.26
201	0.22
202	0.19
203	0.15
204	0.17
205	0.2
206	0.22
207	0.24
208	0.28
209	0.27
210	0.26
211	0.27
212	0.25
213	0.25
214	0.21
215	0.18
216	0.14
217	0.14
218	0.13
219	0.12
220	0.12
221	0.08
222	0.08
223	0.1
224	0.13
225	0.14
226	0.16
227	0.17
228	0.21
229	0.27
230	0.31
231	0.33
232	0.33
233	0.31
234	0.32
235	0.33
236	0.29
237	0.24
238	0.23
239	0.2
240	0.24
241	0.23
242	0.22
243	0.23
244	0.27
245	0.28
246	0.27
247	0.27
248	0.29
249	0.31
250	0.35
251	0.38
252	0.37
253	0.41
254	0.46
255	0.51
256	0.47
257	0.45
258	0.43
259	0.41
260	0.44
261	0.46
262	0.41
263	0.41
264	0.42
265	0.44
266	0.42
267	0.41
268	0.37
269	0.32
270	0.29
271	0.23
272	0.22
273	0.27
274	0.29
275	0.28
276	0.27
277	0.34
278	0.42
279	0.44
280	0.48
281	0.44
282	0.48
283	0.53
284	0.6
285	0.59
286	0.58
287	0.59
288	0.53
289	0.52
290	0.47
291	0.41
292	0.33
293	0.25
294	0.2
295	0.18
296	0.2
297	0.19
298	0.21
299	0.24
300	0.23
301	0.24
302	0.22
303	0.21
304	0.18
305	0.17
306	0.16
307	0.14
308	0.14
309	0.12
310	0.12
311	0.12
312	0.12
313	0.11
314	0.11
315	0.11
316	0.12
317	0.16
318	0.17
319	0.18
320	0.18
321	0.19
322	0.24
323	0.24
324	0.24
325	0.24
326	0.29
327	0.35
328	0.42
329	0.41
330	0.4
331	0.42
332	0.43
333	0.44
334	0.48
335	0.43
336	0.39
337	0.43
338	0.46
339	0.5
340	0.49
341	0.45
342	0.39
343	0.38
344	0.36
345	0.3
346	0.25
347	0.18
348	0.16
349	0.14
350	0.11
351	0.1
352	0.07
353	0.07
354	0.06
355	0.05
356	0.09
357	0.09
358	0.09
359	0.1
360	0.1
361	0.14
362	0.18
363	0.28
364	0.26
365	0.33
366	0.39
367	0.41
368	0.43
369	0.49
370	0.51
371	0.47
372	0.48
373	0.43
374	0.4
375	0.38
376	0.36
377	0.35
378	0.29
379	0.32
380	0.33
381	0.32
382	0.33
383	0.36
384	0.43
385	0.44
386	0.49
387	0.51
388	0.56
389	0.66
390	0.72
391	0.74
392	0.69
393	0.67
394	0.69
395	0.66
396	0.6
397	0.54
398	0.53
399	0.5
400	0.51
401	0.5
402	0.43
403	0.4
404	0.39
405	0.37
406	0.32
407	0.3
408	0.32
409	0.31
410	0.28
411	0.26
412	0.24
413	0.23
414	0.19
415	0.19
416	0.13
417	0.09
418	0.1
419	0.11
420	0.1
421	0.09
422	0.09
423	0.09
424	0.1
425	0.12
426	0.11
427	0.1
428	0.1
429	0.1
430	0.09
431	0.09
432	0.08
433	0.06
434	0.07
435	0.06
436	0.07
437	0.08
438	0.09
439	0.09
440	0.08
441	0.09
442	0.07
443	0.08
444	0.08
445	0.07
446	0.08

A0A367LJB3

3D AlphaFold-predicted Structure Viewer