Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LIX4

Protein Details
Accession A0A367LIX4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-86NRPYRRFCNPIRPGRNRPRPPYSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 8, cyto 6, pero 2
Family & Domain DBs
Amino Acid Sequences PLLSFSFGIAPSAAPLDRAPGNTIGVPIIRCGRSFRSVPLLLLKRIRPLFLLLLPVQSRNPSNRPYRRFCNPIRPGRNRPRPPYSLPPLPHYPRDYLSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.14
5 0.15
6 0.17
7 0.16
8 0.18
9 0.17
10 0.17
11 0.14
12 0.14
13 0.13
14 0.12
15 0.15
16 0.15
17 0.15
18 0.18
19 0.21
20 0.24
21 0.25
22 0.25
23 0.28
24 0.28
25 0.28
26 0.33
27 0.32
28 0.3
29 0.33
30 0.31
31 0.3
32 0.3
33 0.3
34 0.22
35 0.21
36 0.2
37 0.17
38 0.19
39 0.13
40 0.15
41 0.15
42 0.15
43 0.14
44 0.14
45 0.15
46 0.16
47 0.2
48 0.23
49 0.33
50 0.42
51 0.48
52 0.53
53 0.58
54 0.62
55 0.66
56 0.65
57 0.66
58 0.67
59 0.7
60 0.74
61 0.76
62 0.78
63 0.82
64 0.88
65 0.86
66 0.85
67 0.82
68 0.78
69 0.77
70 0.77
71 0.74
72 0.72
73 0.66
74 0.64
75 0.65
76 0.65
77 0.64
78 0.58
79 0.54
80 0.48