Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L123

Protein Details
Accession A0A367L123   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
38-57LSLFAYRLIQKRKERKPSNFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 5, extr 5, E.R. 5, mito 4, cyto 3, golg 2, vacu 2, mito_nucl 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAVISVVKRAPHEHNWAYREPGVVLVFCIVFLVAVGVLSLFAYRLIQKRKERKPSNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.5
4 0.49
5 0.44
6 0.39
7 0.3
8 0.27
9 0.2
10 0.16
11 0.14
12 0.1
13 0.09
14 0.08
15 0.07
16 0.04
17 0.03
18 0.03
19 0.03
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.08
31 0.15
32 0.23
33 0.32
34 0.42
35 0.53
36 0.63
37 0.73