Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LEM2

Protein Details
Accession A0A367LEM2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28PEEKKKKKDPEEKKKKTTNTRTKVRSYABasic
NLS Segment(s)
PositionSequence
4-17KKKKKDPEEKKKKT
Subcellular Location(s) mito 8, cyto 5.5, cyto_nucl 5.5, E.R. 5, nucl 4.5, extr 1, golg 1, cysk 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences PEEKKKKKDPEEKKKKTTNTRTKVRSYAAVVPVVTAVVTAVVTAALGSYPYSAVDLVPDPDPDPDPDPVPVVASVREGKKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.9
4 0.9
5 0.9
6 0.88
7 0.88
8 0.84
9 0.81
10 0.76
11 0.68
12 0.61
13 0.54
14 0.51
15 0.43
16 0.38
17 0.32
18 0.27
19 0.24
20 0.19
21 0.15
22 0.07
23 0.05
24 0.03
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.04
41 0.06
42 0.06
43 0.08
44 0.09
45 0.09
46 0.1
47 0.11
48 0.13
49 0.14
50 0.16
51 0.16
52 0.17
53 0.17
54 0.18
55 0.17
56 0.17
57 0.15
58 0.14
59 0.13
60 0.16
61 0.2
62 0.25