Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LA28

Protein Details
Accession A0A367LA28   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MYVKGKGKKNQNPAMRRPIREHydrophilic
NLS Segment(s)
PositionSequence
7-9GKK
Subcellular Location(s) mito 19, pero 4, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
Amino Acid Sequences MYVKGKGKKNQNPAMRRPIREPRAVGIWEHGVYIASKRRSFKLSALHLITPVAGLVSSPNLVVKDLYAFADTNPLQQNPFLSSPPQPPFPLFSQPTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.75
4 0.72
5 0.74
6 0.7
7 0.67
8 0.61
9 0.53
10 0.52
11 0.49
12 0.41
13 0.33
14 0.3
15 0.23
16 0.21
17 0.18
18 0.12
19 0.11
20 0.14
21 0.18
22 0.19
23 0.22
24 0.24
25 0.27
26 0.29
27 0.31
28 0.32
29 0.34
30 0.35
31 0.37
32 0.37
33 0.35
34 0.32
35 0.29
36 0.25
37 0.16
38 0.11
39 0.06
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.05
47 0.05
48 0.06
49 0.06
50 0.06
51 0.07
52 0.07
53 0.08
54 0.09
55 0.08
56 0.08
57 0.15
58 0.15
59 0.18
60 0.21
61 0.2
62 0.2
63 0.2
64 0.22
65 0.2
66 0.22
67 0.19
68 0.19
69 0.23
70 0.3
71 0.34
72 0.36
73 0.34
74 0.33
75 0.37
76 0.38
77 0.44