Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L3J5

Protein Details
Accession A0A367L3J5   
Localization Confidence High
Confidence Score 21
NoLS Segment(s)
PositionSequenceProtein Nature
7-39GSQNGAPPRIRKKPNPLRPMRKQPRPANPLVAPHydrophilic
183-208APVAKEVNPKRPKKQKEEKIMFNRAPHydrophilic
NLS Segment(s)
PositionSequence
13-52PPRIRKKPNPLRPMRKQPRPANPLVAPAGKAPAPAPAPPK
190-203NPKRPKKQKEEKIM
473-530KDKSKAAPAKGTPTPQGKQKPSDAPKKGKSLKRAGSPALSESSGNESSRKKMRKMASP
568-574PRKKPKL
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008851  TFIIF-alpha  
IPR011039  TFIIF_interaction  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Amino Acid Sequences MSAPPPGSQNGAPPRIRKKPNPLRPMRKQPRPANPLVAPAGKAPAPAPAPPKSSQKATPPATGSTSIEELRKKYGGWSEPPPQPVNDIPIMLTKKAILNGARYHLMRFYQSKMNEKPIDPTDQDDFVRPVTLHRRDPRQPPPGRLPKVEDLEQQQMDEKEVERMAQIKAEREAQRAIDQAKIAPVAKEVNPKRPKKQKEEKIMFNRAPKTEAAKKESDIRYEEALPWHLEDADGKNIWVGTYVAALSESTVGFMIDGSVFRVVPLEKWYKFTSKPPFQPFTLEEAEAFMNKKMDVGRWVMKDEERKAGQNDLEATRRLLYGRGQMVKTESDTFKAASRLEKLDHDDLDISGDEFQDDDEAPHFERNDDEDTKESKERIRREQLGANLFGDGDEQEVDKELQEQLQEELERQKYGKATKKALIKRDREEIYESDDSAEKPWSSSSDDSSDEEDEESKQDEKKEPDAKDGQVEAKDKSKAAPAKGTPTPQGKQKPSDAPKKGKSLKRAGSPALSESSGNESSRKKMRKMASPAAGSRAGTPLPQANPLRRTKAGGDGEATAGEVSDGAGPRKKPKLADNSRKGSPAVSRASSPNPAQGGGASPAHQSGAGIEPWEILEKIPPDGIAIGDLIKLFHGRVGDRSGQMPKAEWIKLVKQLCDYGPDKRLRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.73
4 0.73
5 0.76
6 0.79
7 0.85
8 0.88
9 0.9
10 0.9
11 0.92
12 0.94
13 0.94
14 0.93
15 0.93
16 0.92
17 0.92
18 0.89
19 0.84
20 0.82
21 0.73
22 0.69
23 0.64
24 0.56
25 0.46
26 0.39
27 0.36
28 0.28
29 0.26
30 0.2
31 0.21
32 0.21
33 0.24
34 0.28
35 0.3
36 0.35
37 0.38
38 0.47
39 0.45
40 0.49
41 0.51
42 0.55
43 0.59
44 0.59
45 0.61
46 0.56
47 0.54
48 0.52
49 0.48
50 0.41
51 0.34
52 0.33
53 0.28
54 0.29
55 0.3
56 0.28
57 0.31
58 0.3
59 0.27
60 0.29
61 0.35
62 0.37
63 0.39
64 0.44
65 0.48
66 0.52
67 0.57
68 0.54
69 0.46
70 0.44
71 0.41
72 0.39
73 0.32
74 0.27
75 0.23
76 0.28
77 0.3
78 0.26
79 0.24
80 0.2
81 0.21
82 0.22
83 0.26
84 0.21
85 0.24
86 0.28
87 0.31
88 0.34
89 0.32
90 0.32
91 0.3
92 0.3
93 0.29
94 0.29
95 0.29
96 0.32
97 0.36
98 0.43
99 0.45
100 0.53
101 0.52
102 0.5
103 0.52
104 0.48
105 0.5
106 0.42
107 0.42
108 0.36
109 0.34
110 0.34
111 0.3
112 0.28
113 0.22
114 0.23
115 0.19
116 0.21
117 0.28
118 0.34
119 0.4
120 0.45
121 0.54
122 0.59
123 0.68
124 0.72
125 0.73
126 0.73
127 0.72
128 0.76
129 0.77
130 0.75
131 0.7
132 0.67
133 0.64
134 0.63
135 0.58
136 0.52
137 0.46
138 0.48
139 0.45
140 0.38
141 0.35
142 0.3
143 0.28
144 0.25
145 0.2
146 0.16
147 0.16
148 0.16
149 0.13
150 0.15
151 0.14
152 0.17
153 0.18
154 0.17
155 0.19
156 0.27
157 0.29
158 0.29
159 0.31
160 0.29
161 0.3
162 0.31
163 0.3
164 0.24
165 0.22
166 0.2
167 0.2
168 0.2
169 0.18
170 0.15
171 0.15
172 0.16
173 0.18
174 0.27
175 0.29
176 0.37
177 0.46
178 0.51
179 0.6
180 0.67
181 0.73
182 0.74
183 0.82
184 0.81
185 0.83
186 0.86
187 0.86
188 0.86
189 0.86
190 0.79
191 0.75
192 0.7
193 0.6
194 0.54
195 0.45
196 0.43
197 0.41
198 0.43
199 0.42
200 0.39
201 0.39
202 0.46
203 0.47
204 0.43
205 0.38
206 0.35
207 0.32
208 0.31
209 0.31
210 0.24
211 0.23
212 0.2
213 0.17
214 0.15
215 0.13
216 0.11
217 0.11
218 0.12
219 0.13
220 0.13
221 0.12
222 0.12
223 0.12
224 0.12
225 0.11
226 0.09
227 0.05
228 0.06
229 0.06
230 0.05
231 0.06
232 0.06
233 0.05
234 0.06
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.05
242 0.04
243 0.04
244 0.05
245 0.05
246 0.05
247 0.05
248 0.07
249 0.07
250 0.07
251 0.13
252 0.18
253 0.18
254 0.22
255 0.25
256 0.27
257 0.29
258 0.36
259 0.41
260 0.43
261 0.51
262 0.55
263 0.56
264 0.52
265 0.55
266 0.49
267 0.44
268 0.38
269 0.3
270 0.22
271 0.2
272 0.2
273 0.16
274 0.15
275 0.1
276 0.09
277 0.08
278 0.1
279 0.09
280 0.1
281 0.11
282 0.15
283 0.19
284 0.2
285 0.21
286 0.21
287 0.23
288 0.28
289 0.28
290 0.3
291 0.26
292 0.27
293 0.27
294 0.29
295 0.26
296 0.22
297 0.23
298 0.19
299 0.2
300 0.18
301 0.17
302 0.15
303 0.15
304 0.13
305 0.12
306 0.11
307 0.14
308 0.18
309 0.21
310 0.21
311 0.21
312 0.22
313 0.22
314 0.21
315 0.2
316 0.16
317 0.14
318 0.14
319 0.14
320 0.15
321 0.16
322 0.15
323 0.14
324 0.16
325 0.16
326 0.17
327 0.18
328 0.2
329 0.21
330 0.2
331 0.18
332 0.16
333 0.14
334 0.14
335 0.12
336 0.09
337 0.06
338 0.06
339 0.05
340 0.05
341 0.05
342 0.04
343 0.05
344 0.05
345 0.05
346 0.06
347 0.07
348 0.09
349 0.09
350 0.08
351 0.09
352 0.11
353 0.15
354 0.16
355 0.16
356 0.17
357 0.19
358 0.22
359 0.23
360 0.22
361 0.22
362 0.27
363 0.32
364 0.38
365 0.44
366 0.46
367 0.48
368 0.51
369 0.52
370 0.49
371 0.44
372 0.36
373 0.27
374 0.22
375 0.18
376 0.14
377 0.09
378 0.05
379 0.05
380 0.04
381 0.04
382 0.06
383 0.06
384 0.06
385 0.07
386 0.07
387 0.07
388 0.08
389 0.09
390 0.08
391 0.1
392 0.1
393 0.1
394 0.16
395 0.16
396 0.16
397 0.16
398 0.18
399 0.19
400 0.27
401 0.34
402 0.35
403 0.39
404 0.43
405 0.52
406 0.56
407 0.62
408 0.64
409 0.61
410 0.59
411 0.63
412 0.59
413 0.52
414 0.5
415 0.42
416 0.39
417 0.34
418 0.3
419 0.23
420 0.22
421 0.2
422 0.18
423 0.19
424 0.11
425 0.11
426 0.11
427 0.12
428 0.15
429 0.16
430 0.17
431 0.18
432 0.2
433 0.21
434 0.23
435 0.21
436 0.18
437 0.17
438 0.15
439 0.13
440 0.12
441 0.12
442 0.12
443 0.14
444 0.16
445 0.22
446 0.25
447 0.33
448 0.39
449 0.39
450 0.44
451 0.46
452 0.44
453 0.42
454 0.41
455 0.35
456 0.32
457 0.33
458 0.27
459 0.28
460 0.28
461 0.25
462 0.24
463 0.28
464 0.29
465 0.3
466 0.36
467 0.33
468 0.38
469 0.42
470 0.43
471 0.42
472 0.44
473 0.44
474 0.45
475 0.51
476 0.5
477 0.51
478 0.55
479 0.59
480 0.61
481 0.69
482 0.69
483 0.69
484 0.7
485 0.76
486 0.78
487 0.74
488 0.74
489 0.74
490 0.72
491 0.71
492 0.7
493 0.63
494 0.58
495 0.53
496 0.47
497 0.4
498 0.33
499 0.25
500 0.21
501 0.23
502 0.22
503 0.21
504 0.23
505 0.22
506 0.27
507 0.36
508 0.41
509 0.39
510 0.45
511 0.51
512 0.57
513 0.64
514 0.68
515 0.67
516 0.66
517 0.64
518 0.6
519 0.55
520 0.45
521 0.37
522 0.3
523 0.23
524 0.17
525 0.18
526 0.19
527 0.18
528 0.26
529 0.28
530 0.33
531 0.4
532 0.46
533 0.5
534 0.46
535 0.49
536 0.43
537 0.49
538 0.46
539 0.4
540 0.36
541 0.32
542 0.31
543 0.27
544 0.24
545 0.14
546 0.1
547 0.08
548 0.06
549 0.05
550 0.07
551 0.09
552 0.11
553 0.16
554 0.18
555 0.26
556 0.33
557 0.36
558 0.37
559 0.45
560 0.54
561 0.61
562 0.7
563 0.73
564 0.73
565 0.72
566 0.7
567 0.62
568 0.54
569 0.48
570 0.44
571 0.4
572 0.36
573 0.35
574 0.37
575 0.41
576 0.44
577 0.4
578 0.38
579 0.33
580 0.32
581 0.29
582 0.25
583 0.24
584 0.21
585 0.21
586 0.16
587 0.16
588 0.16
589 0.16
590 0.15
591 0.12
592 0.1
593 0.12
594 0.12
595 0.12
596 0.12
597 0.12
598 0.13
599 0.15
600 0.13
601 0.1
602 0.14
603 0.15
604 0.16
605 0.17
606 0.16
607 0.15
608 0.15
609 0.15
610 0.11
611 0.1
612 0.09
613 0.09
614 0.09
615 0.08
616 0.09
617 0.09
618 0.09
619 0.1
620 0.12
621 0.13
622 0.17
623 0.23
624 0.27
625 0.29
626 0.33
627 0.37
628 0.38
629 0.37
630 0.36
631 0.35
632 0.36
633 0.35
634 0.34
635 0.35
636 0.36
637 0.43
638 0.46
639 0.43
640 0.4
641 0.44
642 0.41
643 0.43
644 0.41
645 0.4
646 0.44
647 0.5