Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LIC8

Protein Details
Accession A0A367LIC8   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-45ITSKGYISKKKKRNHVIKVRKANADHydrophilic
NLS Segment(s)
PositionSequence
28-41SKKKKRNHVIKVRK
Subcellular Location(s) mito 15, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences GKKGPNEVICIPSQRAKPGLITSKGYISKKKKRNHVIKVRKANADNSSKYFSRYFKVPTYSTLTYLYRCAQGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.29
4 0.29
5 0.32
6 0.37
7 0.34
8 0.35
9 0.33
10 0.37
11 0.42
12 0.41
13 0.43
14 0.45
15 0.52
16 0.57
17 0.63
18 0.67
19 0.72
20 0.79
21 0.81
22 0.83
23 0.84
24 0.85
25 0.89
26 0.83
27 0.78
28 0.69
29 0.63
30 0.59
31 0.54
32 0.47
33 0.4
34 0.4
35 0.36
36 0.37
37 0.36
38 0.31
39 0.27
40 0.29
41 0.3
42 0.31
43 0.36
44 0.35
45 0.35
46 0.41
47 0.4
48 0.38
49 0.38
50 0.34
51 0.3
52 0.32
53 0.3
54 0.25