Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367L5N4

Protein Details
Accession A0A367L5N4   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
93-123SDVKLDPTIRERRKRSRRARTRENGHQRCTIHydrophilic
NLS Segment(s)
PositionSequence
102-114RERRKRSRRARTR
Subcellular Location(s) nucl 16.5, cyto_nucl 14.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR001806  Small_GTPase  
IPR020849  Small_GTPase_Ras-type  
Gene Ontology GO:0016020  C:membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF00071  Ras  
Amino Acid Sequences MNLIACFFSRELHVVVLGAAQFVHNEWIESYDPTIEDTYRTQFQVDGRQVVLEILDTAGTEQFANVDEVYTDLCRQILRKDSRYGSSSASVPSDVKLDPTIRERRKRSRRARTRENGHQRCTIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.1
5 0.08
6 0.07
7 0.06
8 0.06
9 0.06
10 0.09
11 0.07
12 0.08
13 0.08
14 0.11
15 0.12
16 0.13
17 0.13
18 0.11
19 0.11
20 0.12
21 0.13
22 0.1
23 0.11
24 0.12
25 0.15
26 0.17
27 0.17
28 0.15
29 0.16
30 0.18
31 0.25
32 0.25
33 0.23
34 0.21
35 0.2
36 0.2
37 0.18
38 0.16
39 0.07
40 0.05
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.03
49 0.03
50 0.04
51 0.05
52 0.05
53 0.05
54 0.04
55 0.05
56 0.06
57 0.06
58 0.06
59 0.05
60 0.06
61 0.06
62 0.07
63 0.11
64 0.19
65 0.25
66 0.29
67 0.35
68 0.38
69 0.42
70 0.43
71 0.41
72 0.35
73 0.31
74 0.28
75 0.23
76 0.21
77 0.18
78 0.16
79 0.15
80 0.14
81 0.12
82 0.12
83 0.14
84 0.15
85 0.16
86 0.24
87 0.34
88 0.41
89 0.5
90 0.57
91 0.66
92 0.75
93 0.83
94 0.87
95 0.88
96 0.9
97 0.91
98 0.94
99 0.93
100 0.92
101 0.92
102 0.93
103 0.9
104 0.84