Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367LNB4

Protein Details
Accession A0A367LNB4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
144-164VTPKKAAATPRKRRAAKKAPVHydrophilic
NLS Segment(s)
PositionSequence
123-126RKRK
146-162PKKAAATPRKRRAAKKA
Subcellular Location(s) cyto 17.5, cyto_nucl 13, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MGNGEKKWDATAERDLCISIIMSISNEGKASYNWPRVTTSMEALGHGFTKDAMSQHFSKVICKDFKNRRGEMPPESTTPSATATPRKRKPAALKLIDENGEGGGDVDDDANVTPSKAAAATPRKRKSAKLAADDGAADVGEAGVTPKKAAATPRKRRAAKKAPVSDDKVDASPPAAEEEADKTLAAAAAAAAAATTIKADVDGTETSADGGEAIAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.26
4 0.25
5 0.2
6 0.1
7 0.08
8 0.07
9 0.07
10 0.1
11 0.11
12 0.11
13 0.11
14 0.11
15 0.12
16 0.12
17 0.18
18 0.24
19 0.31
20 0.32
21 0.34
22 0.35
23 0.35
24 0.39
25 0.36
26 0.29
27 0.26
28 0.25
29 0.24
30 0.22
31 0.21
32 0.17
33 0.15
34 0.13
35 0.07
36 0.08
37 0.09
38 0.09
39 0.11
40 0.14
41 0.16
42 0.17
43 0.21
44 0.21
45 0.23
46 0.26
47 0.31
48 0.32
49 0.33
50 0.42
51 0.48
52 0.56
53 0.6
54 0.58
55 0.58
56 0.59
57 0.61
58 0.57
59 0.53
60 0.47
61 0.42
62 0.43
63 0.36
64 0.3
65 0.26
66 0.22
67 0.18
68 0.17
69 0.24
70 0.3
71 0.4
72 0.45
73 0.51
74 0.52
75 0.57
76 0.64
77 0.65
78 0.66
79 0.62
80 0.58
81 0.54
82 0.54
83 0.47
84 0.38
85 0.28
86 0.18
87 0.12
88 0.09
89 0.07
90 0.04
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.11
106 0.21
107 0.28
108 0.38
109 0.43
110 0.49
111 0.51
112 0.53
113 0.55
114 0.56
115 0.56
116 0.52
117 0.51
118 0.46
119 0.45
120 0.42
121 0.33
122 0.22
123 0.15
124 0.09
125 0.04
126 0.03
127 0.02
128 0.02
129 0.03
130 0.04
131 0.05
132 0.05
133 0.06
134 0.07
135 0.09
136 0.17
137 0.27
138 0.37
139 0.48
140 0.58
141 0.67
142 0.73
143 0.78
144 0.82
145 0.82
146 0.8
147 0.8
148 0.79
149 0.77
150 0.77
151 0.76
152 0.68
153 0.6
154 0.53
155 0.43
156 0.34
157 0.27
158 0.21
159 0.16
160 0.13
161 0.13
162 0.11
163 0.1
164 0.11
165 0.14
166 0.14
167 0.14
168 0.13
169 0.11
170 0.11
171 0.11
172 0.1
173 0.06
174 0.04
175 0.04
176 0.04
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.04
186 0.05
187 0.05
188 0.09
189 0.09
190 0.1
191 0.11
192 0.11
193 0.11
194 0.11
195 0.1
196 0.07