Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A367LIT8

Protein Details
Accession A0A367LIT8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-29VPQARPCLTRQRQKRNAAGDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, pero 2
Family & Domain DBs
Amino Acid Sequences MPFIFTYFRVPQARPCLTRQRQKRNAAGDVVAESAAKTAESSPVVGGGVPPACLRLFQGHLHLLHFQHPVRTCLPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.55
4 0.59
5 0.68
6 0.71
7 0.72
8 0.75
9 0.79
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.43
16 0.34
17 0.27
18 0.19
19 0.13
20 0.09
21 0.07
22 0.06
23 0.05
24 0.04
25 0.04
26 0.06
27 0.06
28 0.07
29 0.06
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.08
40 0.08
41 0.1
42 0.12
43 0.14
44 0.15
45 0.2
46 0.22
47 0.23
48 0.25
49 0.26
50 0.24
51 0.25
52 0.28
53 0.25
54 0.28
55 0.3
56 0.32