Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A367L396

Protein Details
Accession A0A367L396    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-52TISYSKGYTSKKKKRNHKVRKADADDSSHydrophilic
NLS Segment(s)
PositionSequence
35-45KKKKRNHKVRK
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MLNKKERRGTKEEDLQTVRVNVNTTISYSKGYTSKKKKRNHKVRKADADDSSKYFSRYFKVPTCSTLTYLYKIGDLEEDLYVPYPAVSAVLRGVWVRIRPYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.57
3 0.53
4 0.47
5 0.39
6 0.3
7 0.27
8 0.2
9 0.19
10 0.17
11 0.17
12 0.16
13 0.15
14 0.16
15 0.14
16 0.16
17 0.2
18 0.25
19 0.33
20 0.42
21 0.52
22 0.59
23 0.67
24 0.76
25 0.81
26 0.88
27 0.89
28 0.89
29 0.9
30 0.91
31 0.93
32 0.88
33 0.81
34 0.74
35 0.68
36 0.59
37 0.49
38 0.42
39 0.32
40 0.27
41 0.24
42 0.2
43 0.17
44 0.19
45 0.22
46 0.24
47 0.3
48 0.29
49 0.31
50 0.36
51 0.34
52 0.34
53 0.34
54 0.3
55 0.27
56 0.27
57 0.24
58 0.19
59 0.18
60 0.16
61 0.12
62 0.11
63 0.1
64 0.09
65 0.09
66 0.08
67 0.09
68 0.08
69 0.08
70 0.07
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.09
79 0.09
80 0.11
81 0.14
82 0.17